VDAC1 Antikörper (C-Term)

Produktnummer ABIN630114

Der Kaninchen Polyklonal anti-VDAC1 Antikörper (ABIN630114) detektiert spezifisch VDAC1 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte, Maus und Hund.

Kurzübersicht für VDAC1 Antikörper (C-Term) (ABIN630114)

Target: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VDAC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-VDAC1 Antikörper

Bindungsspezifität: C-Term

Spezifität: VDAC1 antibody was raised against the C terminal of VDAC1

Aufreinigung: Purified

Immunogen: VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VDAC1 Blocking Peptide, (ABIN5616953), is also available for use as a blocking control in assays to test for specificity of this VDAC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VDAC1

Target: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Andere Bezeichnung: VDAC1

Hintergrund: The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.

Molekulargewicht: 31 kDa (MW of target protein)