DDX6 Antikörper

Produktnummer ABIN629973

Der Kaninchen Polyklonal anti-DDX6 Antikörper (ABIN629973) detektiert spezifisch DDX6 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Hund.

Kurzübersicht für DDX6 Antikörper (ABIN629973)

Target: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX6 Antikörper

Aufreinigung: Purified

Immunogen: DDX6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX6 Blocking Peptide, (ABIN940070), is also available for use as a blocking control in assays to test for specificity of this DDX6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX6

Target: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Andere Bezeichnung: DDX6

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX6 encodes a DEAD box protein. It may contribute to the cell proliferation and carcinogenesis.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization