DDC Antikörper

Produktnummer ABIN629869

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DDC in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Hund.

Kurzübersicht für DDC Antikörper (ABIN629869)

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-DDC Antikörper

Aufreinigung: Purified

Immunogen: DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDC Blocking Peptide, (ABIN937797), is also available for use as a blocking control in assays to test for specificity of this DDC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDC

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Andere Bezeichnung: DDC

Hintergrund: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis