In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC) Antikörper

Antigen

5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC)

Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Immunhistochemie (IHC), Western Blot (WB)
Produktnummer ABIN629868
Menge 100 ug  (1 mg/ml)  (Varianten)
Preis 376,65 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung ATIC
Immunogen ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT
Beschreibung ATIC is a bifunctional protein requiring dimerization for transformylase activity.
Molekulargewicht 30 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ATIC antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Chromatin und nukleäre Signaltransduktion, DNS/RNS
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC)", Typ "Antikörper" finden
Wirte Maus (16), Kaninchen (10)
Reaktivitäten Human (20), Maus (10), Ratte (Rattus) (10), Fruchtfliege (Drosophila melanogaster) (7), Hund (4), Frosch (4), Rind (Kuh) (2), Affe (2), Huhn (1), Schwein (1)
Applikationen Western Blot (WB) (26), Immunhistochemie (Paraffinschnitte) (IHC (p)) (7), Immunhistochemie (IHC) (5), ELISA (4), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (3), ELISA (Detektionsantikörper) (2), Durchflusszytometrie (FACS) (2), Immunfluoreszenz (IF) (2)
Epitope C-Term (2)