In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Stress-Induced-phosphoprotein 1 (STIP1) Antikörper

Antigen

Stress-Induced-phosphoprotein 1 (STIP1)

Synonyme HOP, P60, STI1, STI1L, IEF-SSP-3521, Hop, p60, Sti1, MGC53256, STIP1, stip1, MGC76181, MGC82554, zgc:92133, MGC128110
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Immunhistochemie (IHC), Western Blot (WB)
Produktnummer ABIN629862
Menge 100 ug  (1 mg/ml)  (Varianten)
Preis 376,65 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung STIP1
Immunogen STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
Beschreibung STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
Molekulargewicht 63 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of STIP1 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion, Hitzeschockproteine
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Stress-Induced-phosphoprotein 1 (STIP1)", Typ "Antikörper" finden
Wirte Maus (14), Kaninchen (13), Huhn (1)
Reaktivitäten Human (25), Maus (4), Huhn (2), Rind (Kuh) (2), Hund (2), Ratte (Rattus) (2)
Applikationen Western Blot (WB) (27), Immunhistochemie (Paraffinschnitte) (IHC (p)) (10), ELISA (9), Immunfluoreszenz (IF) (8), Enzyme Immunoassay (EIA) (7), Durchflusszytometrie (FACS) (4), Immunpräzipitation (IP) (3), ELISA (Detektionsantikörper) (2), Immunhistochemie (IHC) (2)
Epitope C-Term (2), Center (2)