SERPINB5 Antikörper

Produktnummer ABIN629846

Der Kaninchen Polyklonal anti-SERPINB5 Antikörper wird verwendet zum Nachweis von SERPINB5 in Proben von Human. Er wurde validiert für WB und IHC.

Kurzübersicht für SERPINB5 Antikörper (ABIN629846)

Target: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPINB5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SERPINB5 Antikörper

Aufreinigung: Purified

Immunogen: SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINB5 Blocking Peptide, (ABIN5616068), is also available for use as a blocking control in assays to test for specificity of this SERPINB5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPINB5

Target: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Andere Bezeichnung: SERPINB5

Hintergrund: As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: p53 Signalweg