KYNU Antikörper

Produktnummer ABIN629834

Der Kaninchen Polyklonal anti-KYNU Antikörper wird verwendet zum Nachweis von KYNU in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für KYNU Antikörper (ABIN629834)

Target: KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KYNU Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KYNU Antikörper

Aufreinigung: Purified

Immunogen: KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KYNU Blocking Peptide, (ABIN5614400), is also available for use as a blocking control in assays to test for specificity of this KYNU antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KYNU antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KYNU

Target: KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))

Andere Bezeichnung: KYNU

Hintergrund: Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.

Molekulargewicht: 52 kDa (MW of target protein)