ZBP1 Antikörper

Antigen: ZBP1

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN629830

Produktbeschreibung

Immunogen: ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG

Beschreibung: ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.

Molekulargewicht: 47 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZBP1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar