Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) Antikörper

Antigen: Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6)

Synonyme: NCA, CEAL, CD66c

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Immunhistochemie (IHC), Western Blot (WB)

Produktnummer: ABIN629794

Produktbeschreibung

Weitere Bezeichnung: CEACAM6

Immunogen: CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP

Beschreibung: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.

Molekulargewicht: 38 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CEACAM6 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar