NAA50 Antikörper (C-Term)

Produktnummer ABIN629779

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NAA50 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für NAA50 Antikörper (C-Term) (ABIN629779)

Target: NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAA50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NAA50 Antikörper

Bindungsspezifität: C-Term

Spezifität: NAT13 antibody was raised against the C terminal of NAT13

Aufreinigung: Purified

Immunogen: NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAT13 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this NAT13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAA50

Target: NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))

Andere Bezeichnung: NAT13

Hintergrund: NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.

Molekulargewicht: 19 kDa (MW of target protein)