2-4-Dienoyl-Coenzyme A Reductase 2, Peroxisomal (DECR2) Antikörper

Antigen: 2-4-Dienoyl-Coenzyme A Reductase 2, Peroxisomal (DECR2)

Synonyme: Dcrakl, putativeperoxisomal24-dienoyl-CoAreductase

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN629763

Produktbeschreibung

Weitere Bezeichnung: DECR2

Immunogen: DECR2 antibody was raised using the N terminal of DECR2 corresponding to a region with amino acids MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR

Beschreibung: DECR2 is auxiliary enzyme of beta-oxidation. It participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. It catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA and has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Molekulargewicht: 32 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DECR2 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Kardiovaskuläres System, Fettsäuren, Metabolismus, Organelle

Beschränkungen: Nur für Forschungszwecke einsetzbar