In den Warenkorb
Bestellen Sie auch über:
+33 (0)1 76 63 32 65
+33 (0)1 74 18 08 22

Defensin, beta 1 (DEFB1) (AA 1-36) Antikörper

Antigen

Defensin, beta 1 (DEFB1)

Synonyme BD1, HBD1, DEFB-1, DEFB101, MGC51822, mBD-1, AW260221, DEFB1, MGC140110, GAL3, GAL1, DEFB1-like, RHBD-1, Defb1, CBD1
Epitope
Alternativen

AA 1-36

Klonalität Monoklonal (M11-14b-H4)
Wirt
Reaktivität
Alternativen

Human

Applikation
Alternativen Enzyme Immunoassay (EIA), Western Blot (WB)
Produktnummer ABIN192004
Menge 10 µg  (Varianten)
Preis 160,00 €   Zzgl. Versandkosten €40,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 7 bis 10 Werktagen

Produktbeschreibung

Produktmerkmale Synonyms: Beta-defensin 1, BD1, BD-1, HBD1, hBD-1, DEFB1, DEFB101
Weitere Bezeichnung Defensin beta 1
Swiss-Prot P60022
Immunogen Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges)AA Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Kreuzreaktivität Human
Isotyp IgG1  (Passende Sekundärantikörper)
Klon M11-14b-H4
Beschreibung Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodesdefensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelialsurfaces to microbial colonization. This gene maps in close proximity to defensin familymember, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. The mature form of Beta defensin 1 is 36 amino acids.
Spezifität This antibody detects beta-Defensin 1 (aa 1-36). Species: Human. Others not tested. Add. Information: LocusID 1672

Anwendungen

Applikationshinweise ELISA. Western blot. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Reinigung Purified
Buffer 50 mM TRIS pH 7,4Reconstitution: Restore in aqua bidest to 1 mg/ml.
Lagerung Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Defensin, beta 1 (DEFB1)", Typ "Antikörper" finden
Wirte Kaninchen (63), Maus (4)
Reaktivitäten Human (51), Maus (25), Ratte (Rattus) (24), Hund (4), Rind (Kuh) (3), Schwein (3), Pferd (2), Kaninchen (2), Schaf (2), Meerschweinchen (1)
Applikationen Durchflusszytometrie (FACS) (36), Immunfluoreszenz (IF) (36), Western Blot (WB) (25), ELISA (18), Enzyme Immunoassay (EIA) (11), Immunhistochemie (Paraffinschnitte) (IHC (p)) (5), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (4), Immunpräzipitation (IP) (4), Immunoelectron Microscopy (IEM) (2), Radioimmunoassay (RIA) (2)
Konjugate Biotin (6), Alexa Flour 488 (2), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2)
Epitope AA 1-36 (4), AA 1-5 (4), AA 18-26 (4), AA 28-34 (4)