In den Warenkorb
Bestellen Sie auch über:
+33 (0)1 76 63 32 65
+33 (0)1 74 18 08 22

Parathyroid Hormone (PTH) (AA 1-38) Antikörper

Antigen

Parathyroid Hormone (PTH)

Synonyme PTH1, Pthp, MGC117651, Pth1, Pthr1, PTH-(1-84), PTH
Epitope
Alternativen

AA 1-38

Klonalität Monoklonal (A1-64)
Wirt
Reaktivität
Alternativen

Human

Applikation
Alternativen Immunhistochemie (Gefrierschnitte) (IHC (fro)), Enzyme Immunoassay (EIA), Immunhistochemie (Paraffinschnitte) (IHC (p)), Radioimmunoassay (RIA)
Produktnummer ABIN191956
Menge 10 µg  (Varianten)
Preis 100,00 €   Zzgl. Versandkosten €40,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 7 bis 10 Werktagen

Produktbeschreibung

Produktmerkmale Synonyms: Parathormone, Parathyrin
Weitere Bezeichnung Parathyroid hormone / PTH
Swiss-Prot P01270
Immunogen Synthetic human PTH (aa 1-38) poly Lysin conjugatedAA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
Kreuzreaktivität Human
Isotyp IgG1  (Passende Sekundärantikörper)
Klon A1-64
Spezifität This antibody detects PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic PTH (aa 1-3, 1-10, 4-16, 28-48,39-84, 44-68, 53-84,), PTHrP (aa 1- 86). Species: Human. Others not tested. Add. Information: LocusID 5741

Anwendungen

Applikationshinweise RIA (25 ng/ml). Immunohistochemistry (cryo-sections and paraffinsections, 2 ug/ml). ELISA (1 ug/ml). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Reinigung Purified
Buffer 50 mM TRIS pH 7,4, NaN3 0.05 %Reconstitution: Restore in aqua bidest to 1 mg/ml.
Lagerung Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Parathyroid Hormone (PTH)", Typ "Antikörper" finden
Wirte Maus (66), Kaninchen (31), Ziege (7), Schaf (3), Ratte (2)
Reaktivitäten Human (96), Ratte (Rattus) (2)
Applikationen Enzyme Immunoassay (EIA) (58), Radioimmunoassay (RIA) (34), ELISA (27), Immunhistochemie (Paraffinschnitte) (IHC (p)) (19), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (17), Western Blot (WB) (15), Immunhistochemie (IHC) (6), Dot Blot (Dot) (3), ELISA (Detektionsantikörper) (1), Immunfluoreszenz (IF) (1), Immunpräzipitation (IP) (1)
Konjugate Biotin (2)
Epitope AA 1-38 (17), AA 1-34 (13), AA 1-10 (10), AA 32-155 (9), AA 44-68 (4), AA 28-48 (2), N-Term AA 1-34 (2), AA 32-116 (1), Amino Acids 15-25 (1), amino acids 53-68 (1), amino acids 53-84 (1)