In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Defensin, beta 1 (DEFB1) (AA 1-36) Antikörper

Antigen

Defensin, beta 1 (DEFB1)
Synonyme BD1, HBD1, DEFB-1, DEFB101, MGC51822, mBD-1, AW260221, DEFB1, MGC140110, GAL3, GAL1, DEFB1-like, RHBD-1, Defb1, CBD1
Epitope
Alternativen

AA 1-36
Klonalität Monoklonal (M4-14b-H4)
Wirt
Reaktivität
Alternativen

Human
Applikation
Alternativen ELISA, Western Blot (WB)
Produktnummer ABIN109994
Menge 100 µg  (Varianten)
Preis 440,00 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferbar innerhalb von 3 bis 5 Werktagen

Produktbeschreibung
Anwendungen Alternativen Sekundärantikörper Varianten zurück nach oben

Weitere Bezeichnung beta-Defensin 1 (aa 1-36)
Immunogen Synthetic human 61538-Defensin 1 (aa 1-36) (3 disulfide bridges)(dhyncvssggqclysacpiftkiqgtcyrgkakcck)
Isotyp IgG1  (Passende Sekundärantikörper)
Klon M4-14b-H4
Beschreibung Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4
Spezifität Synthetic human 61538-Defensin 1 (aa- 1-36)

Anwendungen
Alternativen Sekundärantikörper Varianten zurück nach oben

Applikationshinweise ELISA, Western blot This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
Lagerung 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided
Forschungsgebiet Immunologie
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen
Anwendungen Sekundärantikörper Varianten zurück nach oben

Alternativen zu Antigen "Defensin, beta 1 (DEFB1)", Typ "Antikörper" finden
Wirte Kaninchen (62), Maus (4)
Reaktivitäten Human (48), Maus (18), Ratte (Rattus) (17), Affe (1)
Applikationen Western Blot (WB) (34), Durchflusszytometrie (FACS) (26), Immunfluoreszenz (IF) (26), ELISA (22), Enzyme Immunoassay (EIA) (12), Immunhistochemie (Paraffinschnitte) (IHC (p)) (5), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (4), Immunpräzipitation (IP) (4), Immunelektronenmikroskopie (EM) (2), Radioimmunoassay (RIA) (2)
Konjugate Biotin (6), Alexa Flour 488 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy7 (2), RBITC (2)
Epitope AA 28-34 (5), AA 1-36 (4), AA 1-5 (4), AA 18-26 (4)