In den Warenkorb
Bestellen Sie auch über:
![]() |
+49 (0)241 95 163 153 |
![]() |
+49 (0)241 95 163 155 |
Calcitonin-Related Polypeptide alpha (CALCA) Antikörper
| Antigen | Calcitonin-Related Polypeptide alpha (CALCA) |
| Synonyme | CALCA, CALC3, MGC152154, CT, KC, CGRP, CALC1, CGRP1, CGRP-I, MGC126648, CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, HsT2645, 2410002I16Rik, 5830420C16Rik, CALC, calcitonin, calca, ci-ct |
| Klonalität | Polyklonal |
| Wirt |
Alternativen Ziege |
| Reaktivität |
Alternativen Human |
| Applikation |
Alternativen Radioimmunoassay (RIA)
|
| Produktnummer | ABIN109808 |
| Menge | 100 µl (Varianten) |
| Preis | 320,00 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferung in 3 bis 5 Werktagen |
Produktbeschreibung
| Weitere Bezeichnung | Calcitonin-Gene related Peptide |
| Gen-ID | LocusID 797 |
| Immunogen | Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf) |
| Beschreibung | Serum |
| Spezifität | Human Calcitonin Gene-related Peptide There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin |
Anwendungen
| Applikationshinweise | RIA (1/3,000) |
| Lagerung | 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided |
| Forschungsgebiet | Hormone |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |
Alternativen
Alternativen zu Antigen "Calcitonin-Related Polypeptide alpha (CALCA)", Typ "Antikörper" finden




Alternativen