anti-Human TINF2 Antikörper für Western Blotting

Recommended TINF2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
TIN2 (TINF2) Antikörper
  • DKCA3
  • TIN2
  • AW552114
  • D14Wsu146e
  • Tin2
  • TERF1 interacting nuclear factor 2
  • Terf1 (TRF1)-interacting nuclear factor 2
  • TINF2
  • Tinf2
Reaktivität
Human
70
23
2
2
2
2
1
1
1
Wirt
Kaninchen
40
25
5
Klonalität
Polyklonal
Konjugat
Dieser TINF2 Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
59
23
22
19
12
5
3
3
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Bilder

Produktnummer ABIN631193
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.735656 ABIN6265586 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
12.463114 ABIN3187272 ELISA IHC WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
12.463114 ABIN5620984 IHC WB Rabbit Center Anmelden zum Anzeigen Polyclonal 0
12.463114 ABIN2153256 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
12.463114 ABIN2153254 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
12.463114 ABIN6149187 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
9.235656 ABIN531985 WB Mouse IgG1 Anmelden zum Anzeigen 59B388-1 5
7.735656 ABIN2707179 IHC WB Rabbit Center Anmelden zum Anzeigen Polyclonal 0
7.735656 ABIN6259622 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.735656 ABIN525684 IF WB Mouse AA 1-451 Anmelden zum Anzeigen Polyclonal 0
7 ABIN525685 ELISA WB Mouse IgG2b kappa AA 256-354 Anmelden zum Anzeigen 3G11 0
4.735656 ABIN2787641 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
4.735656 ABIN1534093 ELISA WB Rabbit IgG AA 71-120 Anmelden zum Anzeigen Polyclonal 1
4.735656 ABIN2460038 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.735656 ABIN6570695 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.735656 ABIN2560425 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.735656 ABIN5589536 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.735656 ABIN3047613 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.1922464 ABIN269685 GS ICC IF WB Mouse IgG1 Anmelden zum Anzeigen 59B388-1 12
4 ABIN464103 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0

General

Antigen TIN2 (TINF2) Antikörper
Reaktivität Human
(70), (23), (2), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(40), (25), (5)
Klonalität
Polyklonal
Konjugat Dieser TINF2 Antikörper ist unkonjugiert
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(59), (23), (22), (19), (12), (5), (3), (3), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TINF2 Antikörper

Target Details TINF2 Anwendungsinformationen Handhabung Bilder
Reinigung Affinity purified
Immunogen TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR
Plasmids, Primers & others

Target Details TINF2

Produktdetails anti-TINF2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TINF2 (TINF2 Antibody Abstract)
Hintergrund TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends, without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.
Molekulargewicht 50 kDa (MW of target protein)
Pathways Zellzyklus, Telomere Maintenance, Regulation of Carbohydrate Metabolic Process

Anwendungsinformationen

Produktdetails anti-TINF2 Antikörper Target Details TINF2 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TINF2 Blocking Peptide, catalog no. 33R-8348, is also available for use as a blocking control in assays to test for specificity of this TINF2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TINF2 Antikörper Target Details TINF2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINF2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-TINF2 Antikörper Target Details TINF2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-TIN2 (TINF2) antibody (ABIN631193) TINF2 antibody used at 1 ug/ml to detect target protein.