anti-Human TINF2 Antikörper für Western Blotting

Recommended TINF2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
TIN2 (TINF2) Antikörper
  • DKCA3
  • TIN2
  • AW552114
  • D14Wsu146e
  • Tin2
  • TERF1 interacting nuclear factor 2
  • Terf1 (TRF1)-interacting nuclear factor 2
  • TINF2
  • Tinf2
Reaktivität
Human
68
22
2
2
2
2
1
1
1
Wirt
Kaninchen
39
24
5
Klonalität
Polyklonal
Konjugat
Dieser TINF2 Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
57
23
22
19
12
5
3
3
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN631193
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.802607 ABIN6265586 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN3187272 ELISA IHC WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN5620984 IHC WB Rabbit Center Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN2153256 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN2153254 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN6149187 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN2707179 IHC WB Rabbit Center Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN6259622 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN525684 IF WB Mouse AA 1-451, full length Anmelden zum Anzeigen Polyclonal 0
7 ABIN525685 ELISA WB Mouse IgG2b kappa AA 256-354, partial Anmelden zum Anzeigen 3G11 0
4.8026066 ABIN2787641 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
4.8026066 ABIN1534093 ELISA WB Rabbit IgG AA 71-120 Anmelden zum Anzeigen Polyclonal 1
4.8026066 ABIN2460038 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN5968357 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN2560425 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN5589536 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN3047613 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4 ABIN464103 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
4 ABIN2889739 ELISA WB Rabbit IgG AA 71-120 Anmelden zum Anzeigen Polyclonal 0
4 ABIN272251 WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen TIN2 (TINF2) Antikörper
Reaktivität Human
(68), (22), (2), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(39), (24), (5)
Klonalität
Polyklonal
Konjugat Dieser TINF2 Antikörper ist unkonjugiert
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(57), (23), (22), (19), (12), (5), (3), (3), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TINF2 Antikörper

Target Details TINF2 Anwendungsinformationen Handhabung Bilder
Reinigung Affinity purified
Immunogen TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR
Plasmids, Primers & others

Target Details TINF2

Produktdetails anti-TINF2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung TINF2 (TINF2 Antibody Abstract)
Hintergrund TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends, without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.
Molekulargewicht 50 kDa (MW of target protein)
Pathways Zellzyklus, Telomere Maintenance, Regulation of Carbohydrate Metabolic Process

Anwendungsinformationen

Produktdetails anti-TINF2 Antikörper Target Details TINF2 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TINF2 Blocking Peptide, catalog no. 33R-8348, is also available for use as a blocking control in assays to test for specificity of this TINF2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TINF2 Antikörper Target Details TINF2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINF2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-TINF2 Antikörper Target Details TINF2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-TIN2 (TINF2) antibody (ABIN631193) TINF2 antibody used at 1 ug/ml to detect target protein.