anti-Human MYT1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended MYT1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Myelin Transcription Factor 1 (MYT1) Antikörper
  • fc56h05
  • myt1
  • si:dkey-202m22.5
  • wu:fc56h05
  • C20orf36
  • MTF1
  • MYTI
  • PLPB1
  • ZC2HC4A
  • Nzf2
  • Nzf2a
  • Nzf2b
  • Nztf2
  • myelin transcription factor 1
  • myelin transcription factor 1a
  • myelin transcription factor 1 S homeolog
  • MYT1
  • myt1a
  • Myt1
  • myt1.S
Reaktivität
Human
101
29
25
4
4
3
2
1
1
Wirt
Kaninchen
97
7
Klonalität
Polyklonal
Konjugat
Dieser MYT1 Antikörper ist unkonjugiert
7
7
7
5
5
5
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
81
58
29
14
10
9
2
2
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4337585
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN389599 DB IHC (p) WB Rabbit Ig Fraction pThr495 Anmelden zum Anzeigen Polyclonal 1
1 ABIN2879226 ELISA IHC IHC (p) WB Rabbit IgG AA 41-90 Anmelden zum Anzeigen Polyclonal 0
1 ABIN747332 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN744203 IF (p) IHC (p) WB Rabbit IgG pSer83 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5957968 ELISA IHC (p) WB Rabbit IgG Ser83 Anmelden zum Anzeigen Polyclonal 0
1 ABIN747325 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN747323 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2963514 IHC (p) ELISA WB Rabbit IgG AA 41-90 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5507885 IHC (p) Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0

General

Antigen Myelin Transcription Factor 1 (MYT1) Antikörper
Reaktivität Human
(101), (29), (25), (4), (4), (3), (2), (1), (1)
Wirt Kaninchen
(97), (7)
Klonalität
Polyklonal
Konjugat Dieser MYT1 Antikörper ist unkonjugiert
(7), (7), (7), (5), (5), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(81), (58), (29), (14), (10), (9), (2), (2), (2)
Pubmed 3 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-MYT1 Antikörper

Target Details MYT1 Anwendungsinformationen Handhabung Referenzen für anti-MYT1 Antikörper (ABIN4337585) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPLDT
Isotyp IgG
Plasmids, Primers & others

Target Details MYT1

Produktdetails anti-MYT1 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-MYT1 Antikörper (ABIN4337585) Bilder zurück nach oben
Antigen
Andere Bezeichnung Myt1 (MYT1 Antibody Abstract)
Hintergrund Gene Symbol: MYT1
Gen-ID 4661
Pathways Zellzyklus

Anwendungsinformationen

Produktdetails anti-MYT1 Antikörper Target Details MYT1 Handhabung Referenzen für anti-MYT1 Antikörper (ABIN4337585) Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-MYT1 Antikörper Target Details MYT1 Anwendungsinformationen Referenzen für anti-MYT1 Antikörper (ABIN4337585) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-MYT1 Antikörper (ABIN4337585)

Produktdetails anti-MYT1 Antikörper Target Details MYT1 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Islam, Smith, Niu, Fang, Iqbal, Sun, Shi, Zhang: "Enhancer Analysis Unveils Genetic Interactions between TLX and SOX2 in Neural Stem Cells and In Vivo Reprogramming." in: Stem cell reports, Vol. 5, Issue 5, pp. 805-15, 2016 (Probematerial (Species): Mouse (Murine)). Weitere Details: Immunoprecipitation

Chandrasekar, Dreyer: "The Brain-Specific Neural Zinc Finger Transcription Factor 2b (NZF-2b/7ZFMyt1) Suppresses Cocaine Self-Administration in Rats." in: Frontiers in behavioral neuroscience, Vol. 4, pp. 14, 2010

Chandrasekar, Dreyer: "The brain-specific Neural Zinc Finger transcription factor 2b (NZF-2b/7ZFMyt1) causes suppression of cocaine-induced locomotor activity." in: Neurobiology of disease, Vol. 37, Issue 1, pp. 86-98, 2009

Bilder

Produktdetails anti-MYT1 Antikörper Target Details MYT1 Anwendungsinformationen Handhabung Referenzen für anti-MYT1 Antikörper (ABIN4337585) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Myelin Transcription Factor 1 (MYT1) antibody (ABIN4337585) Immunohistochemistry: Myt1 Antibody [NBP1-81021] - Staining of human stomach shows st...
Immunofluorescence (IF) image for anti-Myelin Transcription Factor 1 (MYT1) antibody (ABIN4337585) Immunocytochemistry/Immunofluorescence: Myt1 Antibody [NBP1-81021] - ICC-IF analysis ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Myelin Transcription Factor 1 (MYT1) antibody (ABIN4337585) Immunohistochemistry-Paraffin: Myt1 Antibody - Staining of human cerebellum shows mo...