anti-Human GADD45B Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended GADD45B Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Growth Arrest and DNA-Damage-Inducible, beta (GADD45B) Antikörper
  • CS131
  • cb196
  • gadd45b
  • gadd45b2
  • sb:cb196
  • zgc:73104
  • gadd45beta
  • wu:fa92d10
  • wu:fa98h12
  • wu:fk65h03
  • zgc:111973
  • AI323528
  • Myd118
  • GADD45BETA
  • MYD118
  • growth arrest and DNA-damage-inducible, beta a
  • growth arrest and DNA damage inducible beta
  • growth arrest and DNA-damage-inducible 45 beta
  • growth arrest and DNA-damage-inducible, beta
  • gadd45ba
  • GADD45B
  • Gadd45b
Reaktivität
Human
34
27
27
5
3
1
1
1
1
Wirt
Kaninchen
34
Klonalität
Polyklonal
Konjugat
Dieser GADD45B Antikörper ist unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
13
13
9
8
4
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4336943
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN759596 IF (p) IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 1
1 ABIN759598 IHC (p) Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 1
1 ABIN759605 IHC (p) HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5578590 IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Growth Arrest and DNA-Damage-Inducible, beta (GADD45B) Antikörper
Reaktivität Human
(34), (27), (27), (5), (3), (1), (1), (1), (1)
Wirt Kaninchen
(34)
Klonalität
Polyklonal
Konjugat Dieser GADD45B Antikörper ist unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(13), (13), (9), (8), (4), (3), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-GADD45B Antikörper

Target Details GADD45B Anwendungsinformationen Handhabung Referenzen für anti-GADD45B Antikörper (ABIN4336943) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY
Isotyp IgG

Target Details GADD45B

Produktdetails anti-GADD45B Antikörper Anwendungsinformationen Handhabung Referenzen für anti-GADD45B Antikörper (ABIN4336943) Bilder zurück nach oben
Antigen
Andere Bezeichnung MYD118 (GADD45B Antibody Abstract)
Hintergrund Gene Symbol: GADD45B
Gen-ID 4616
Pathways Zellzyklus

Anwendungsinformationen

Produktdetails anti-GADD45B Antikörper Target Details GADD45B Handhabung Referenzen für anti-GADD45B Antikörper (ABIN4336943) Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-GADD45B Antikörper Target Details GADD45B Anwendungsinformationen Referenzen für anti-GADD45B Antikörper (ABIN4336943) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-GADD45B Antikörper (ABIN4336943)

Produktdetails anti-GADD45B Antikörper Target Details GADD45B Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Rizzardi, Rosener, Koopmeiners, Isaksson Vogel, Metzger, Forster, Marston, Tiffany, McCarthy, Turley, Warlick, Henriksen, Schmechel: "Evaluation of protein biomarkers of prostate cancer aggressiveness." in: BMC cancer, Vol. 14, pp. 244, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Bilder

Produktdetails anti-GADD45B Antikörper Target Details GADD45B Anwendungsinformationen Handhabung Referenzen für anti-GADD45B Antikörper (ABIN4336943) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Growth Arrest and DNA-Damage-Inducible, beta (GADD45B) antibody (ABIN4336943) Western Blot: MYD118 Antibody [NBP1-87990] - Lane 1: Marker [kDa] 250, 130, 100, 70, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Growth Arrest and DNA-Damage-Inducible, beta (GADD45B) antibody (ABIN4336943) Immunohistochemistry-Paraffin: MYD118 Antibody [NBP1-87990] - Staining of human rectu...
Immunofluorescence (IF) image for anti-Growth Arrest and DNA-Damage-Inducible, beta (GADD45B) antibody (ABIN4336943) Immunocytochemistry/Immunofluorescence: MYD118 Antibody [NBP1-87990] - Staining of hu...