anti-Human E2F4 Antikörper für Immunofluorescence

Recommended E2F4 Antibody (geliefert von: Anmelden zum Anzeigen )

E2F Transcription Factor 4, P107/p130-Binding (E2F4) Antikörper
  • E2F-4
  • 2010111M04Rik
  • AI427446
  • E2F4
  • e2f-4
  • fb72f07
  • wu:fb72f07
  • wu:fe05f06
  • zgc:63815
  • E2F transcription factor 4
  • E2F transcription factor 4 S homeolog
  • E2F4
  • E2f4
  • e2f4.S
  • e2f4
Dieser E2F4 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5076416
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN439334 ICC IF IHC IHC (p) IP PLA WB Rabbit AA 363-413 Anmelden zum Anzeigen Polyclonal 1
1 ABIN115206 IF IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 4E2F04 3
1 ABIN487490 IF IP WB Mouse IgG1 Anmelden zum Anzeigen TFE42 0
1 ABIN115205 IF IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 4E2F04 0
1 ABIN384006 GS IF IHC IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 4E2F04 0
1 ABIN1978608 IF IHC IHC (p) Rabbit IgG AA 363-413 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2256953 IF IHC WB Mouse IgG1 Anmelden zum Anzeigen 3F377 0
1 ABIN384009 GS IF IHC IHC (p) WB Biotin Mouse IgG1 Anmelden zum Anzeigen 4E2F04 0
1 ABIN2256954 IF IHC WB Mouse IgG1 Anmelden zum Anzeigen 3F377 0


Antigen E2F Transcription Factor 4, P107/p130-Binding (E2F4) Antikörper
Reaktivität Human
(93), (41), (39), (7), (6), (5), (5), (5), (5), (3), (3), (2), (1)
Wirt Kaninchen
(54), (25), (17)
Konjugat Dieser E2F4 Antikörper ist unkonjugiert
(5), (4), (3), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(85), (61), (31), (17), (11), (9), (2), (2), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-E2F4 Antikörper

Target Details E2F4 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD
Isotyp IgG
Plasmids, Primers & others

Target Details E2F4

Produktdetails anti-E2F4 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung E2F-4 (E2F4 Antibody Abstract)
Hintergrund Gene Symbol: E2F4
Gen-ID 1874
Pathways Zellzyklus, Mitotic G1-G1/S Phases, Regulation of Cell Size


Produktdetails anti-E2F4 Antikörper Target Details E2F4 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-E2F4 Antikörper Target Details E2F4 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-E2F4 Antikörper Target Details E2F4 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-E2F Transcription Factor 4, P107/p130-Binding (E2F4) antibody (ABIN5076416) Immunocytochemistry/Immunofluorescence: E2F-4 Antibody - Staining of human cell line...