anti-Human COPS5 Antikörper für Immunofluorescence

Recommended COPS5 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) Antikörper
  • BcDNA.LD14392
  • BcDNA:LD14392
  • CG14884
  • CH5
  • CSN-5
  • Csn5
  • DCH5
  • Dch5
  • Dmel\\CG14884
  • JAB1
  • JAB1/CSN5
  • Jab1
  • JadBp
  • csn5
  • dch5
  • jab1/csn5
  • l(3)89Cf
  • l(3)L4032
  • l(3)M203
  • quo
  • COPS5
  • MGC76063
  • AI303502
  • CSN5
  • Mov34
  • Sgn5
  • zgc:73130
  • MOV-34
  • SGN5
  • COP9 signalosome subunit 5
  • COP9 signalosome complex subunit 5
  • COP9 signalosome subunit 5 S homeolog
  • CSN5
  • COPS5
  • cops5
  • CpipJ_CPIJ012314
  • Bm1_46585
  • VDBG_06932
  • LOAG_01443
  • csn5
  • Cops5
  • cops5.S
  • csn-5
Reaktivität
Human, Maus, Ratte (Rattus)
118
103
65
18
7
7
7
5
4
4
3
3
3
2
1
1
1
Wirt
Kaninchen
75
53
1
Klonalität
Polyklonal
Konjugat
Dieser COPS5 Antikörper ist unkonjugiert
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
111
61
42
38
31
21
19
14
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4327830
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.579758 ABIN1533317 IF ELISA WB Rabbit IgG AA 374-423 Anmelden zum Anzeigen Polyclonal 0
10.579758 ABIN5077577 ICC IF Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
10.579758 ABIN6138883 IF WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN267291 ICC IF IHC IP WB Mouse IgG2b Anmelden zum Anzeigen 2A10 8
1 ABIN1498920 IF IHC IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen 2B12 0
1 ABIN315581 ICC IF IHC (p) IP IHC WB Mouse IgG2b Anmelden zum Anzeigen 2A10-8 0
1 ABIN5499241 IF IHC IHC (p) IP WB Mouse IgG2b Anmelden zum Anzeigen 2A10-8 0
1 ABIN5611382 IF IHC (p) IP WB Mouse IgG2b Anmelden zum Anzeigen 2A10-8 0
1 ABIN6260970 ELISA ICC IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2469776 IF IP IHC WB Mouse IgG2b full length Anmelden zum Anzeigen 2A10-8 0
1 ABIN5575848 IF IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2882092 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN6247647 ICC IF IHC WB Mouse IgG1 Anmelden zum Anzeigen OTI2B12 0
1 ABIN1977960 IF IHC IHC (p) WB Rabbit IgG AA 175-225 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1977961 IF IHC IHC (p) Rabbit IgG AA 175-225 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1822333 IF IP WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN5964294 IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN4327833 ICC IF IHC WB DyLight 405 Mouse IgG2b Anmelden zum Anzeigen 2A10 0
1 ABIN4327837 ICC IF IHC WB DyLight 755 Mouse IgG2b Anmelden zum Anzeigen 2A10 0
1 ABIN4327838 ICC IF IHC WB DyLight 488 Mouse IgG2b Anmelden zum Anzeigen 2A10 0

General

Antigen COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(118), (103), (65), (18), (7), (7), (7), (5), (4), (4), (3), (3), (3), (2), (1), (1), (1)
Wirt Kaninchen
(75), (53), (1)
Klonalität
Polyklonal
Konjugat Dieser COPS5 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(111), (61), (42), (38), (31), (21), (19), (14), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-COPS5 Antikörper

Target Details COPS5 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLS
Isotyp IgG
Plasmids, Primers & others

Target Details COPS5

Produktdetails anti-COPS5 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung JAB1 (COPS5 Antibody Abstract)
Hintergrund Gene Symbol: COPS5
Gen-ID 10987
Pathways Zellzyklus

Anwendungsinformationen

Produktdetails anti-COPS5 Antikörper Target Details COPS5 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-COPS5 Antikörper Target Details COPS5 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-COPS5 Antikörper Target Details COPS5 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Western Blot: JAB1 Antibody [NBP1-84370] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32,...
Immunofluorescence (IF) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunocytochemistry/Immunofluorescence: JAB1 Antibody [NBP1-84370] - Staining of huma...
Western Blotting (WB) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Western Blot: JAB1 Antibody [NBP1-84370] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunohistochemistry-Paraffin: JAB1 Antibody [NBP1-84370] - Immunohistochemical stain...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunohistochemistry-Paraffin: JAB1 Antibody - Staining of human testis shows strong...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunocytochemistry/Immunofluorescence: JAB1 Antibody - Immunofluorescent staining o...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunohistochemistry-Paraffin: JAB1 Antibody - Staining of human endometrium shows m...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunohistochemistry-Paraffin: JAB1 Antibody - Staining of human placenta shows stro...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunohistochemistry-Paraffin: JAB1 Antibody - Staining of human skin shows moderate...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis) (COPS5) antibody (ABIN4327830) Immunohistochemistry-Paraffin: JAB1 Antibody - Staining of human testis shows strong...