anti-Maus WNT5A Antikörper für Immunochromatography

Recommended WNT5A Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) Antikörper
  • hWNT5A
  • wnt-5A
  • wnt5a-B
  • WNT5A
  • 8030457G12Rik
  • Wnt-5a
  • Wnt family member 5A
  • Wnt family member 5A S homeolog
  • wingless-type MMTV integration site family, member 5a
  • wingless-type MMTV integration site family, member 5A
  • wingless-related MMTV integration site 5A
  • Wnt signaling ligand
  • WNT5A
  • Wnt5a
  • wnt5a.S
  • wnt5a
  • LOC578814
  • wnt5
Epitop
AA 62-381
36
15
15
11
11
7
7
6
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
Reaktivität
Maus
178
65
51
19
17
16
2
2
1
1
1
1
1
Wirt
Kaninchen
133
56
2
Klonalität
Polyklonal
Konjugat
Dieser WNT5A Antikörper ist unkonjugiert
11
10
8
5
5
4
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Applikation
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
150
74
62
57
17
13
10
10
6
4
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN2387017
$ 551.57
Zzgl. Versandkosten $45.00

General

Antigen Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) Antikörper
Epitop AA 62-381
(36), (15), (15), (11), (11), (7), (7), (6), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Maus
(178), (65), (51), (19), (17), (16), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(133), (56), (2)
Klonalität
Polyklonal
Konjugat Dieser WNT5A Antikörper ist unkonjugiert
(11), (10), (8), (5), (5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(150), (74), (62), (57), (17), (13), (10), (10), (6), (4), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-WNT5A Antikörper

Target Details WNT5A Anwendungsinformationen Handhabung Bilder
Sequenz MSPILGYWKI KGLVQPTRLL LEYLEEKYEE HLYERDEGDK WRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIA WPLQGWQATF GGGDHPPKSD LEVLFQGPLG SPEF-IIGAQPLCSQ LAGLSQGQK KLCHLYQDHM QYIGEGAKTG IKECQYQFRH RRWNCSTVDN TSVFGRVMQI GSRETAFTYA VSAAGVVNAM SRACREGELS TCGCSRAARP KDLPRDWLWG GCGDNIDYGY RFAKEFVDAR ERERIHAKGS YESARILMNL HNNEAGRRTV YNLADVACKC HGVSGSCSLK TCWLQLADFR KVGDALKEKY DSAAAMRLNS RGKLVQVNSR FNSPTTQDLV YIDPSPDYCV RNESTGSLGT QGRLCNKTSE GMDGCELMCC GRGYDQFKTV QTERCHCKFH WCCYVKCKKC TEIVDQFVCK
Kreuzreaktivität Maus
Kreuzreaktivität (Details) Calculated cross reactivity: Mo
Produktmerkmale Wingless Type MMTV Integration Site Family, Member 5A (WNT5A)
Reinigung Purified by immunoaffinity chromatography.
Immunogen WNT5A (Ile62~Lys381), MSPILGYWKI KGLVQPTRLL LEYLEEKYEE HLYERDEGDK WRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEF-IIGAQPLCS QLAGLSQGQK KLCHLYQDHM QYIGEGAKTG IKECQYQFRH RRWNCSTVDN TSVFGRVMQI GSRETAFTYA VSAAGVVNAM SRACREGELS TCGCSRAARP KDLPRDWLWG GCGDNIDYGY RFAKEFVDAR ERERIHAKGS YESARILMNL HNNEAGRRTV YNLADVACKC HGVSGSCSLK TCWLQLADFR KVGDALKEKY DSAAAMRLNS RGKLVQVNSR FNSPTTQDLV YIDPSPDYCV RNESTGSLGT QGRLCNKTSE GMDGCELMCC GRGYDQFKTV QTERCHCKFH WCCYVKCKKC TEIVDQFVCK
Isotyp IgG
Plasmids, Primers & others

Target Details WNT5A

Produktdetails anti-WNT5A Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Wingless Type MMTV Integration Site Family, Member 5A (WNT5A Antibody Abstract)
Pathways WNT Signalweg, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Regulation of Cell Size, Tube Formation

Anwendungsinformationen

Produktdetails anti-WNT5A Antikörper Target Details WNT5A Handhabung Bilder zurück nach oben
Applikations-hinweise Optimal working conditions should be determined by the investigator.
Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-WNT5A Antikörper Target Details WNT5A Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung -20°C