anti-Maus PLCD1 Antikörper für Western Blotting

Recommended PLCD1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
phospholipase C, delta 1 (PLCD1) Antikörper
  • NDNC3
  • PLC-III
  • AW212592
  • C79986
  • Plc1
  • phospholipase C delta 1
  • phospholipase C, delta 1
  • PLCD1
  • Plcd1
Epitop
N-Term
14
10
8
4
2
2
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
46
12
11
4
4
3
3
2
2
1
1
1
Wirt
Kaninchen
46
1
Klonalität
Polyklonal
Konjugat
Dieser PLCD1 Antikörper ist unkonjugiert
3
3
3
2
2
2
Applikation
Western Blotting (WB)
41
28
7
4
3
3
2
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN634425
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.755764 ABIN6388517 ELISA WB Rabbit IgG AA 90-170 Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN2786844 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.8026066 ABIN2786843 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.8026066 ABIN6264284 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN2459977 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.8026066 ABIN5855256 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4 ABIN464047 WB Rabbit IgG AA 71-120 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5696830 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1090188 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2920047 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5855257 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN6034082 IF/ICC IHC IP WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen phospholipase C, delta 1 (PLCD1) Antikörper
Epitop N-Term
(14), (10), (8), (4), (2), (2), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(46), (12), (11), (4), (4), (3), (3), (2), (2), (1), (1), (1)
Wirt Kaninchen
(46), (1)
Klonalität
Polyklonal
Konjugat Dieser PLCD1 Antikörper ist unkonjugiert
(3), (3), (3), (2), (2), (2)
Applikation Western Blotting (WB)
(41), (28), (7), (4), (3), (3), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PLCD1 Antikörper

Target Details PLCD1 Anwendungsinformationen Handhabung Bilder
Spezifität PLCD1 antibody was raised against the N terminal of PLCD1
Reinigung Affinity purified
Immunogen PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
Plasmids, Primers & others

Target Details PLCD1

Produktdetails anti-PLCD1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PLCD1 (PLCD1 Antibody Abstract)
Hintergrund Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.
Molekulargewicht 86 kDa (MW of target protein)
Pathways WNT Signalweg, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process

Anwendungsinformationen

Produktdetails anti-PLCD1 Antikörper Target Details PLCD1 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PLCD1 Blocking Peptide, catalog no. 33R-2003, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PLCD1 Antikörper Target Details PLCD1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-PLCD1 Antikörper Target Details PLCD1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-phospholipase C, delta 1 (PLCD1) (N-Term) antibody (ABIN634425) PLCD1 antibody used at 1 ug/ml to detect target protein.