anti-Maus PKC beta Antikörper für Western Blotting

Recommended PKC beta Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Protein Kinase C, beta (PRKCB) Antikörper
  • PKC-beta
  • PKCB
  • PRKCB1
  • PRKCB2
  • A130082F03Rik
  • PKC-Beta
  • Pkcb
  • Prkcb1
  • Prkcb2
  • PKC-B
  • Prkcb
  • prkcb1
  • zgc:63591
  • PKC
  • PRKCB_tv2
  • Pkc53E
  • prkcb1l
  • zgc:64063
  • protein kinase C beta
  • protein kinase C, beta
  • protein kinase C, beta b
  • protein kinase C, beta a
  • PRKCB
  • Prkcb
  • prkcbb
  • prkcba
Epitop
N-Term
38
17
16
15
14
14
11
9
9
9
7
6
5
4
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
196
137
136
23
20
14
10
5
4
3
2
2
2
1
1
1
Wirt
Kaninchen
212
18
8
5
1
Klonalität
Polyklonal
Konjugat
Dieser PKC beta Antikörper ist unkonjugiert
18
16
8
6
6
6
2
2
2
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
215
116
105
27
25
17
14
13
11
8
4
3
3
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN634421
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
16.55837 ABIN634422 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN3186468 ELISA WB Rabbit IgG Thr290 Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN3182327 ELISA IHC WB Rabbit IgG pSer661 Anmelden zum Anzeigen Polyclonal 0
12.755764 ABIN2149136 ELISA WB Rabbit IgG pSer661 Anmelden zum Anzeigen Polyclonal 0
12.302607 ABIN391003 IHC (p) WB Rabbit Ig Fraction AA 642-673, C-Term Anmelden zum Anzeigen Polyclonal 1
10.802607 ABIN1870521 IF IHC WB Rabbit IgG pThr641 Anmelden zum Anzeigen Polyclonal 0
10.802607 ABIN2737417 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
10.802607 ABIN2987562 IF/ICC IHC WB Rabbit IgG pThr641 Anmelden zum Anzeigen Polyclonal 0
10.802607 ABIN5963920 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
9.302607 ABIN3043550 WB Rabbit IgG AA 542-671 Anmelden zum Anzeigen Polyclonal 2
9.302607 ABIN2786693 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
7.8026066 ABIN6255455 ELISA ICC IF WB Rabbit IgG pSer661 Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN6271958 ELISA ICC IF WB Rabbit IgG pThr500 Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN6264249 ELISA ICC IF WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN6271222 ELISA IHC WB Rabbit IgG pSer660 Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN3032235 IHC ELISA WB Rabbit Ig Fraction AA 642-673 Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN2998168 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN2995246 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN2424915 IF IHC WB Rabbit IgG pThr641 Anmelden zum Anzeigen Polyclonal 0
7.8026066 ABIN2434186 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Protein Kinase C, beta (PRKCB) Antikörper
Epitop N-Term
(38), (17), (16), (15), (14), (14), (11), (9), (9), (9), (7), (6), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(196), (137), (136), (23), (20), (14), (10), (5), (4), (3), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(212), (18), (8), (5), (1)
Klonalität
Polyklonal
Konjugat Dieser PKC beta Antikörper ist unkonjugiert
(18), (16), (8), (6), (6), (6), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(215), (116), (105), (27), (25), (17), (14), (13), (11), (8), (4), (3), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PKC beta Antikörper

Target Details PKC beta Anwendungsinformationen Handhabung Bilder
Spezifität PRKCB1 antibody was raised against the N terminal of PRKCB1
Reinigung Affinity purified
Immunogen PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC
Plasmids, Primers & others

Target Details PKC beta

Produktdetails anti-PKC beta Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PRKCB1 (PRKCB Antibody Abstract)
Hintergrund Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
Molekulargewicht 77 kDa (MW of target protein)
Pathways WNT Signalweg, T-Zell Rezeptor Signalweg, Thyroid Hormone Synthesis, Nuclear Hormone Receptor Binding, Chromatin Binding, Myometrial Relaxation and Contraction, VEGF Signaling, Unfolded protein response

Anwendungsinformationen

Produktdetails anti-PKC beta Antikörper Target Details PKC beta Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PRKCB1 Blocking Peptide, catalog no. 33R-5625, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PKC beta Antikörper Target Details PKC beta Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-PKC beta Antikörper Target Details PKC beta Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Protein Kinase C, beta (PRKCB) (N-Term) antibody (ABIN634421) PRKCB1 antibody used at 1 ug/ml to detect target protein.