anti-Schwein FZD10 Antikörper für Immunofluorescence

Recommended FZD10 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Frizzled Family Receptor 10 (FZD10) Antikörper
  • CD350
  • FZ-10
  • Fz10
  • FzE7
  • hFz10
  • cFz-10
  • Fz-10
  • Xfr9
  • Xfz10
  • frizzled-10
  • frizzled10
  • fz10
  • fze7
  • hfz10
  • fk48e04
  • fz4
  • fzb
  • wu:fk48e04
  • zg04
  • Fzd10
  • Xfz10B
  • Xfz9
  • fzd10b
  • fzd9
  • frizzled class receptor 10
  • frizzled class receptor 2
  • frizzled class receptor 10 S homeolog
  • FZD10
  • fzd10
  • Fzd10
  • Fzd2
  • fzd10.S
Reaktivität
Human, Schwein
54
47
24
6
4
4
3
3
2
2
1
Wirt
Kaninchen
61
Klonalität
Polyklonal
Konjugat
Dieser FZD10 Antikörper ist unkonjugiert
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunofluorescence (IF)
36
19
15
13
9
7
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN2602863
$ 551.83
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5516677 IF Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen Frizzled Family Receptor 10 (FZD10) Antikörper
Reaktivität Human, Schwein
(54), (47), (24), (6), (4), (4), (3), (3), (2), (2), (1)
Wirt Kaninchen
(61)
Klonalität
Polyklonal
Konjugat Dieser FZD10 Antikörper ist unkonjugiert
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunofluorescence (IF)
(36), (19), (15), (13), (9), (7), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FZD10 Antikörper

Target Details FZD10 Anwendungsinformationen Handhabung Bilder
Spezifität Human FZD10 / Frizzled 10
Reinigung Immunoaffinity purified
Immunogen The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%), Dog, Horse, Mouse, Bovine (92%).

Type of Immunogen: Synthetic peptide

Target Details FZD10

Produktdetails anti-FZD10 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung FZD10 / Frizzled 10 (FZD10 Antibody Abstract)
Hintergrund Name/Gene ID: FZD10
Subfamily: Frizzled
Family: GPCR

Synonyms: FZD10, CD350 antigen, CD350, FZ-10, Frizzled homolog 10, HFz10, Frizzled 10, Frizzled family receptor 10, Frizzled-10, FzE7, Fz10
Gen-ID 11211
Pathways WNT Signalweg

Anwendungsinformationen

Produktdetails anti-FZD10 Antikörper Target Details FZD10 Handhabung Bilder zurück nach oben
Applikationshinweise Optimal working dilution should be determined by the investigator.
Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FZD10 Antikörper Target Details FZD10 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Distilled water
Konzentration Lot specific
Buffer Lyophilized from PBS, 2 % sucrose.
Handhabung Avoid freeze-thaw cycles.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Long term: -20°C
Short term: +4°C
Avoid freeze-thaw cycles.