anti-Human SLC11A1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended SLC11A1 Antibody (geliefert von: Anmelden zum Anzeigen )

Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 1 (SLC11A1) Antikörper
  • SLC11A1
  • NRAMP1
  • LSH
  • Bcg
  • Itg
  • Lsh
  • Nramp1
  • Ity
  • Nramp
  • ity
  • BCG
  • solute carrier family 11 member 1 L homeolog
  • solute carrier family 11 member 1
  • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1
  • slc11a1.L
  • SLC11A1
  • Slc11a1
Dieser SLC11A1 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4340633
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1804590 IF IHC IHC (p) WB Rabbit AA 250-276 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1817895 FACS ICC IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2964217 IF IHC (p) WB Rabbit AA 256-285 Anmelden zum Anzeigen Polyclonal 0


Antigen Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 1 (SLC11A1) Antikörper
Reaktivität Human
(44), (8), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(32), (14)
Konjugat Dieser SLC11A1 Antikörper ist unkonjugiert
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(35), (15), (10), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SLC11A1 Antikörper

Target Details SLC11A1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR
Isotyp IgG
Plasmids, Primers & others

Target Details SLC11A1

Produktdetails anti-SLC11A1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung NRAMP1/SLC11A1 (SLC11A1 Antibody Abstract)
Hintergrund Gene Symbol: SLC11A1
Gen-ID 6556
Pathways Transition Metal Ion Homeostasis, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus


Produktdetails anti-SLC11A1 Antikörper Target Details SLC11A1 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-SLC11A1 Antikörper Target Details SLC11A1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-SLC11A1 Antikörper Target Details SLC11A1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 1 (SLC11A1) antibody (ABIN4340633) Immunohistochemistry: NRAMP1/SLC11A1 Antibody [NBP1-87809] - Staining of human testis...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 1 (SLC11A1) antibody (ABIN4340633) Immunohistochemistry-Paraffin: NRAMP1/SLC11A1 Antibody - Staining of human lymph nod...