anti-Maus UNC93B1 Antikörper für Western Blotting

Recommended UNC93B1 Antibody (geliefert von: Anmelden zum Anzeigen )

Unc-93 Homolog B1 (C. Elegans) (UNC93B1) Antikörper
  • UNC93
  • IIAE1
  • UNC93B
  • Unc-93B1
  • Unc93b
  • unc-93 homolog B1, TLR signaling regulator
  • unc-93 homolog B1 (C. elegans)
  • UNC93B1
  • Unc93b1
Human, Maus, Ratte (Rattus)
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN630393
$ 437.50
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
7.751972 ABIN615007 EIA IHC (p) WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
7.751972 ABIN1031653 IHC ELISA WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
7 ABIN343917 ELISA IHC IHC (p) WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
5.5 ABIN1003411 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 2
4.751972 ABIN2783996 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.751972 ABIN2463309 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN6568613 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN3024029 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN6292324 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4 ABIN321713 WB Rabbit IgG AA 61-110 Anmelden zum Anzeigen Polyclonal 0
4 ABIN207765 WB Rabbit IgG AA 500-550 Anmelden zum Anzeigen Polyclonal 0
4 ABIN1386855 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4 ABIN1740587 IHC (p) ELISA WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2745212 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN6252539 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN5555409 EIA IHC (p) WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2382661 WB Rabbit IgG AA 500-550 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1888104 IHC ELISA WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
-8.25825 ABIN4364376 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 2
-12.75825 ABIN4364372 ELISA ICC IF IHC IHC (p) WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0


Antigen Unc-93 Homolog B1 (C. Elegans) (UNC93B1) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(32), (21), (20), (5), (3), (2), (2), (2), (1)
Wirt Kaninchen
(32), (1)
Applikation Western Blotting (WB)
(31), (12), (11), (10), (3), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-UNC93B1 Antikörper

Target Details UNC93B1 Anwendungsinformationen Handhabung Bilder
Reinigung Purified
Immunogen UNC93 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK
Plasmids, Primers & others

Target Details UNC93B1

Produktdetails anti-UNC93B1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung UNC93B1 (UNC93B1 Antibody Abstract)
Hintergrund UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.
Molekulargewicht 67 kDa (MW of target protein)
Pathways TLR Signalweg, Activation of Innate immune Response, Toll-Like Receptors Cascades


Produktdetails anti-UNC93B1 Antikörper Target Details UNC93B1 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

UNC93B1 Blocking Peptide, catalog no. 33R-5095, is also available for use as a blocking control in assays to test for specificity of this UNC93B1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-UNC93B1 Antikörper Target Details UNC93B1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC90 1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Produktdetails anti-UNC93B1 Antikörper Target Details UNC93B1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Unc-93 Homolog B1 (C. Elegans) (UNC93B1) antibody (ABIN630393) UNC93B1 antibody used at 5 ug/ml to detect target protein.