anti-Maus TAB1 Antikörper für Western Blotting

Recommended TAB1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1) Antikörper
  • 3'-Tab1
  • MAP3K7IP1
  • 2310012M03Rik
  • Map3k7ip1
  • b2b449Clo
  • TGF-beta activated kinase 1 (MAP3K7) binding protein 1
  • TGF-beta activated kinase 1/MAP3K7 binding protein 1
  • TAB1
  • Tab1
Epitop
N-Term
18
11
10
10
9
9
8
6
6
5
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
178
69
50
8
6
5
4
3
3
2
1
1
1
1
Wirt
Kaninchen
148
28
2
Klonalität
Polyklonal
Konjugat
Dieser TAB1 Antikörper ist unkonjugiert
8
8
7
6
6
6
2
2
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
136
81
21
19
17
16
12
9
9
3
3
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN634348
$ 473.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.751972 ABIN6269553 ELISA IHC WB Rabbit IgG pTyr481 Anmelden zum Anzeigen Polyclonal 0
12.811332 ABIN4902330 WB Mouse N-Term Anmelden zum Anzeigen 0
10.751972 ABIN2423759 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.751972 ABIN6263110 ELISA IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.751972 ABIN1031115 ICC ELISA WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
7 ABIN214510 ICC IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN2785275 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.751972 ABIN6271814 ELISA WB Rabbit IgG pSer438 Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN6270400 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN3042547 WB Rabbit IgG AA 304-321, C-Term Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN2737641 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN6258903 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN2968031 IF/ICC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN3198337 WB Rabbit Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN5923309 WB Rabbit pSer438 Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN6006154 WB Rabbit IgG full length Anmelden zum Anzeigen Polyclonal 0
4.751972 ABIN3029117 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
4 ABIN469577 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
4 ABIN303281 IF IHC (p) WB Rabbit Center Anmelden zum Anzeigen Polyclonal 1
4 ABIN333172 ELISA WB Mouse IgG2a, kappa Anmelden zum Anzeigen 0

General

Antigen TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1) Antikörper
Epitop N-Term
(18), (11), (10), (10), (9), (9), (8), (6), (6), (5), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(178), (69), (50), (8), (6), (5), (4), (3), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(148), (28), (2)
Klonalität
Polyklonal
Konjugat Dieser TAB1 Antikörper ist unkonjugiert
(8), (8), (7), (6), (6), (6), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(136), (81), (21), (19), (17), (16), (12), (9), (9), (3), (3), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TAB1 Antikörper

Target Details TAB1 Anwendungsinformationen Handhabung Bilder
Spezifität MAP3 K3 P1 antibody was raised against the N terminal of MAP3 3 P1
Reinigung Affinity purified
Immunogen MAP3 K3 P1 antibody was raised using the N terminal of MAP3 3 P1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE
Plasmids, Primers & others

Target Details TAB1

Produktdetails anti-TAB1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung MAP3K7IP1 (TAB1 Antibody Abstract)
Hintergrund The protein encoded by this gene was identified as a regulator of the MAP kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1.
Molekulargewicht 50 kDa (MW of target protein)
Pathways TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades

Anwendungsinformationen

Produktdetails anti-TAB1 Antikörper Target Details TAB1 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MAP3K7IP1 Blocking Peptide, catalog no. 33R-5608, is also available for use as a blocking control in assays to test for specificity of this MAP3K7IP1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TAB1 Antikörper Target Details TAB1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 0 P1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-TAB1 Antikörper Target Details TAB1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1 (TAB1) (N-Term) antibody (ABIN634348) MAP3K7IP1 antibody used at 1 ug/ml to detect target protein.