anti-Ratte (Rattus) IRF5 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended IRF5 Antibody (geliefert von: Anmelden zum Anzeigen )

Interferon Regulatory Factor 5 (IRF5) Antikörper
  • IRF5
  • irf5
  • SLEB10
  • AW491843
  • mirf5
  • im:7155364
  • zgc:76986
  • interferon regulatory factor 5
  • interferon regulatory factor 5 L homeolog
  • IRF5
  • irf5
  • Irf5
  • irf5.L
AA 442-472, C-Term
Human, Maus, Ratte (Rattus)
Dieser IRF5 Antikörper ist unkonjugiert
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen


Produktnummer ABIN3043861
$ 280.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
6.8131976 ABIN5946616 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG N-Term Anmelden zum Anzeigen SD203-07 0
1 ABIN5552797 ChIP EIA IHC (p) IP WB Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN4951486 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0


Antigen Interferon Regulatory Factor 5 (IRF5) Antikörper
Epitop AA 442-472, C-Term
(28), (17), (11), (9), (6), (5), (5), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(144), (83), (37), (11), (7), (7), (6), (5), (4), (3), (3)
Wirt Kaninchen
(77), (57), (20), (9), (4)
Konjugat Dieser IRF5 Antikörper ist unkonjugiert
(4), (4), (4), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(140), (78), (53), (41), (34), (31), (25), (9), (7), (6), (4), (2), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-IRF5 Antikörper

Target Details IRF5 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: interferon regulatory factor 5
Protein Name: Interferon regulatory factor 5
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
Isotyp IgG
Plasmids, Primers & others

Target Details IRF5

Produktdetails anti-IRF5 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung IRF5 (IRF5 Antibody Abstract)
Hintergrund Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. IRF5 gene is mapped to 7q32.1. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. This gene is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection.

Synonyms: Interferon regulatory factor 5 antibody|Interferon regulatory factor 5 bone marrow variant antibody|IRF 5 antibody|IRF-5 antibody|Irf5 antibody|IRF5_HUMAN antibody|SLEB10 antibody
Gen-ID 3663
UniProt Q13568
Pathways TLR Signalweg, Autophagie


Produktdetails anti-IRF5 Antikörper Target Details IRF5 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-IRF5 Antikörper Target Details IRF5 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Produktdetails anti-IRF5 Antikörper Target Details IRF5 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) Anti- IRF5 Picoband antibody, IHC(P) IHC(P): Human Mammary Cancer Tissue
Immunohistochemistry (IHC) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) Anti- IRF5 Picoband antibody, IHC(P) IHC(P): Mouse Spleen Tissue
Immunohistochemistry (IHC) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) Anti- IRF5 Picoband antibody, IHC(P) IHC(P): Rat Spleen Tissue
Western Blotting (WB) image for anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (ABIN3043861) anti-Interferon Regulatory Factor 5 (IRF5) (AA 442-472), (C-Term) antibody (Image 4)