anti-Human Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon (IKBKE) Antikörper
  • zgc:100844
  • IKBKE
  • MGC130907
  • IKK-E
  • IKK-i
  • IKKE
  • IKKI
  • AW558201
  • IKKepsilon
  • Ikki
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon
  • inhibitor of nuclear factor kappa B kinase subunit epsilon
  • inhibitor of nuclear factor kappa B kinase subunit epsilon L homeolog
  • inhibitor of kappaB kinase epsilon
  • IKBKE
  • ikbke
  • ikbke.L
  • Ikbke
Reaktivität
Human
117
52
28
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
107
30
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
5
5
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
117
64
46
20
15
4
4
2
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4324307
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.951965 ABIN4324306 ELISA IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 1
12.951965 ABIN442996 ICC IF IHC (p) IHC WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN392751 IHC (p) WB Rabbit Ig Fraction AA 686-716, C-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN213741 IHC IHC (p) WB Rabbit IgG AA 701-716 Anmelden zum Anzeigen Polyclonal 0
1 ABIN360635 EIA IHC (p) WB Rabbit Ig Fraction C-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN1387735 IF (p) IHC (p) WB Rabbit IgG pSer172 Anmelden zum Anzeigen Polyclonal 0
1 ABIN754033 IF (p) IHC (p) WB Rabbit IgG AA 530-580 Anmelden zum Anzeigen Polyclonal 0
1 ABIN302678 IHC (p) WB Rabbit AA 701-716 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2623795 IHC IHC (p) WB Mouse IgG1 AA 474-716 Anmelden zum Anzeigen 3C5 0
1 ABIN1960176 IHC IHC (p) WB Rabbit IgG AA 123-636 Anmelden zum Anzeigen Polyclonal 0
1 ABIN754042 IHC (p) WB HRP Rabbit IgG AA 530-580 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5630290 ELISA IHC IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN523135 IHC (p) ELISA Mouse IgG2b kappa AA 541-640, partial Anmelden zum Anzeigen 1F7 0
1 ABIN754035 IHC (p) WB Biotin Rabbit IgG AA 530-580 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1735857 IHC (p) WB Rabbit IgG AA 701-716 Anmelden zum Anzeigen Polyclonal 0
1 ABIN872297 IF (p) IHC (p) WB Rabbit IgG pThr501 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2894313 IHC IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN1805373 IHC IHC (p) WB Rabbit AA 686-716 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2963112 IHC (p) WB Rabbit IgG AA 123-636 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2768628 IHC (p) WB Rabbit AA 701-716 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon (IKBKE) Antikörper
Reaktivität Human
(117), (52), (28), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(107), (30)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(5), (5), (5), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(117), (64), (46), (20), (15), (4), (4), (2), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLN
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Antigen
Andere Bezeichnung IKK epsilon/ikbke (IKBKE Antibody Abstract)
Hintergrund Gene Symbol: IKBKE
Gen-ID 9641
Pathways TLR Signalweg, Activation of Innate immune Response, Hepatitis C, Toll-Like Receptors Cascades

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen

Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Sun, Sammut, Wang, Kurihara, Windle, Roodman, Galson: "TBK1 mediates critical effects of measles virus nucleocapsid protein (MVNP) on pagetic osteoclast formation." in: Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, Vol. 29, Issue 1, pp. 90-102, 2013 (Probematerial (Species): Mouse (Murine)). Weitere Details: Western Blotting

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon (IKBKE) antibody (ABIN4324307) Immunocytochemistry/Immunofluorescence: IKBKE Antibody [NBP1-83114] Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase epsilon (IKBKE) antibody (ABIN4324307) Immunohistochemistry-Paraffin: IKBKE Antibody [NBP1-83114] - Staining of human pancre...