anti-Maus ITK Antikörper für Western Blotting

Recommended ITK Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
IL2-Inducible T-Cell Kinase (ITK) Antikörper
  • Emt
  • Tcsk
  • Tsk
  • EMT
  • LPFS1
  • LYK
  • PSCTK2
  • IL2 inducible T cell kinase
  • IL2 inducible T-cell kinase
  • IL2-inducible T-cell kinase
  • Itk
  • ITK
Epitop
AA 575-617, C-Term
23
17
17
12
9
8
5
4
4
3
2
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus
116
26
25
3
2
Wirt
Kaninchen
72
35
24
Klonalität
Polyklonal
Konjugat
Dieser ITK Antikörper ist unkonjugiert
8
7
6
6
6
6
Applikation
Western Blotting (WB)
116
85
15
10
8
6
6
5
4
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5518767
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
3.1493068 ABIN1873325 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
3.1493068 ABIN1868785 ICC IHC WB Rabbit IgG AA 368-625 Anmelden zum Anzeigen Polyclonal 0
3.1493068 ABIN2563488 ELISA WB Goat IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN5552654 WB Goat C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN680653 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5928223 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2746783 ELISA IHC IP WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5928221 WB Rabbit pTyr512 Anmelden zum Anzeigen Polyclonal 0
1 ABIN6101383 ELISA IHC WB Rabbit IgG pTyr512 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2746782 ELISA IHC IP WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2624369 WB Rabbit AA 156-190 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1906120 WB Rabbit AA 1-50 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5703865 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2934404 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1087337 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2934403 IF/ICC IHC IP WB Rabbit AA 368-625 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5647872 WB Rabbit IgG AA 575-617 Anmelden zum Anzeigen Polyclonal 0
1 ABIN6055997 IF/ICC IHC WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5928225 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN6031874 IF/ICC IHC IP WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen IL2-Inducible T-Cell Kinase (ITK) Antikörper
Epitop AA 575-617, C-Term
(23), (17), (17), (12), (9), (8), (5), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus
(116), (26), (25), (3), (2)
Wirt Kaninchen
(72), (35), (24)
Klonalität
Polyklonal
Konjugat Dieser ITK Antikörper ist unkonjugiert
(8), (7), (6), (6), (6), (6)
Applikation Western Blotting (WB)
(116), (85), (15), (10), (8), (6), (6), (5), (4), (3), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ITK Antikörper

Target Details ITK Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ITK/TSK(ITK) detection. Tested with WB in Human,Mouse.
Sequenz FRLYKPRLAS THVYQIMNHC WKERPEDRPA FSRLLRQLAE IAE
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ITK/TSK(ITK) detection. Tested with WB in Human,Mouse.
Gene Name: IL2 inducible T-cell kinase
Protein Name: Tyrosine-protein kinase ITK/TSK
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ITK (575-617aa FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE), different from the related mouse sequence by five amino acids.
Isotyp IgG
Plasmids, Primers & others

Target Details ITK

Produktdetails anti-ITK Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung ITK (ITK Antibody Abstract)
Hintergrund Tyrosine-protein kinase ITK/TSK, also known as interleukin-2-inducible T-cell kinase or simply ITK, is a protein that in humans is encoded by the ITK gene. It is a member of the TEC family of kinases. This gene is mapped to 5q33.3. This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein is thought to play a role in T-cell proliferation and differentiation. Furthermore, ITK is functionally important for the development and effector function of Th2 and Th17 cells.

Synonyms: EMT | Itk | LPFS1 | LYK | PSCTK 2 | PSCTK2 | TSK | Q08881
Gen-ID 3702
UniProt Q08881
Pathways T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung

Anwendungsinformationen

Produktdetails anti-ITK Antikörper Target Details ITK Handhabung Bilder zurück nach oben
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ITK Antikörper Target Details ITK Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-ITK Antikörper Target Details ITK Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-IL2-Inducible T-Cell Kinase (ITK) (AA 575-617), (C-Term) antibody (ABIN5518767) Western blot analysis of ITK expression in HELA whole cell lysates ( Lane 1) and NIH3...