anti-Human TECTA Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended TECTA Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Tectorin alpha (TECTA) Antikörper
  • DFNA12
  • DFNA8
  • DFNB21
  • Tctna
  • tectorin alpha
  • TECTA
  • Tecta
Reaktivität
Human
8
2
2
Wirt
Kaninchen
5
3
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
7
5
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4358355
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5518790 IHC (p) WB Rabbit IgG AA 93-134, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN5647724 IHC (p) WB Rabbit IgG AA 93-134 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Tectorin alpha (TECTA) Antikörper
Reaktivität Human
(8), (2), (2)
Wirt Kaninchen
(5), (3)
Klonalität
Polyklonal
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(7), (5), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TECTA Antikörper

Target Details TECTA Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VLHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKIGGIGASEVKLNGQE
Isotyp IgG

Target Details TECTA

Produktdetails anti-TECTA Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung Tectorin alpha (TECTA Antibody Abstract)
Hintergrund Gene Symbol: TECTA
Gen-ID 7007
Pathways Sensory Perception of Sound

Anwendungsinformationen

Produktdetails anti-TECTA Antikörper Target Details TECTA Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TECTA Antikörper Target Details TECTA Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-TECTA Antikörper Target Details TECTA Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tectorin alpha (TECTA) antibody (ABIN4358355) Immunohistochemistry-Paraffin: Tectorin alpha Antibody - Staining of human testis sh...