anti-Human ROS1 Antikörper für Immunofluorescence

Recommended ROS1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) Antikörper
  • MCF3
  • ROS
  • c-ros-1
  • ROS1C
  • Ros-1
  • c-ros
  • ROS proto-oncogene 1, receptor tyrosine kinase
  • ROS proto-oncogene 1 , receptor tyrosine kinase
  • Ros1 proto-oncogene
  • ROS1
  • Ros1
Reaktivität
Human
181
10
7
4
3
3
3
3
2
Wirt
Kaninchen
147
31
12
Klonalität
Polyklonal
Konjugat
Dieser ROS1 Antikörper ist unkonjugiert
9
8
8
7
7
6
6
6
6
6
6
6
6
6
6
6
6
6
5
5
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
149
112
36
21
18
17
11
10
6
6
4
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5079381
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5552251 EIA IF IHC (p) WB Rabbit Ig Fraction AA 33-63, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2579391 ELISA IF IHC IHC (p) WB Rabbit IgG AA 23-56 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5952705 FACS ICC IF Janelia Fluor® 549 Mouse IgG1 Anmelden zum Anzeigen 4-6G 0
1 ABIN5952706 FACS ICC IF Janelia Fluor® 646 Mouse IgG1 Anmelden zum Anzeigen 4-6G 0
1 ABIN5952707 FACS ICC IF Janelia Fluor® 549 Mouse IgG1 Anmelden zum Anzeigen 5-4E 0
1 ABIN5952708 FACS ICC IF Janelia Fluor® 646 Mouse IgG1 Anmelden zum Anzeigen 5-4E 0
1 ABIN5952709 FACS ICC IF Janelia Fluor® 549 Mouse IgG1 Anmelden zum Anzeigen 7-1B 0
1 ABIN5952710 FACS ICC IF Janelia Fluor® 646 Mouse IgG1 Anmelden zum Anzeigen 7-1B 0
1 ABIN5952711 FACS ICC IF Janelia Fluor® 549 Mouse IgG1 Anmelden zum Anzeigen 7-2B 0
1 ABIN5952712 FACS ICC IF Janelia Fluor® 646 Mouse IgG1 Anmelden zum Anzeigen 7-2B 0
1 ABIN5952713 FACS ICC IF Janelia Fluor® 549 Mouse IgG1 Anmelden zum Anzeigen 7-6G 0
1 ABIN5952714 FACS ICC IF Janelia Fluor® 646 Mouse IgG1 Anmelden zum Anzeigen 7-6G 0
1 ABIN4350974 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 7-1B 0
1 ABIN4350973 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 5-4E 0
1 ABIN4350972 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 4-6G 0
1 ABIN4350975 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 7-2B 0
1 ABIN4350977 CyTOF FACS Func IF IHC IP WB Mouse IgG1 Anmelden zum Anzeigen C-ROS 0
1 ABIN4350976 CyTOF FACS Func ICC IF IP WB Mouse IgG1 Anmelden zum Anzeigen 7-6G 0

General

Antigen C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) Antikörper
Reaktivität Human
(181), (10), (7), (4), (3), (3), (3), (3), (2)
Wirt Kaninchen
(147), (31), (12)
Klonalität
Polyklonal
Konjugat Dieser ROS1 Antikörper ist unkonjugiert
(9), (8), (8), (7), (7), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (5), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(149), (112), (36), (21), (18), (17), (11), (10), (6), (6), (4), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ROS1 Antikörper

Target Details ROS1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DVICLNSDDIMPVALMETKNREGLNYMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHSGYGDGSD
Isotyp IgG
Plasmids, Primers & others

Target Details ROS1

Produktdetails anti-ROS1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung ROS (ROS1 Antibody Abstract)
Hintergrund Gene Symbol: ROS1
Gen-ID 6098
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-ROS1 Antikörper Target Details ROS1 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ROS1 Antikörper Target Details ROS1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-ROS1 Antikörper Target Details ROS1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) antibody (ABIN5079381) Immunocytochemistry/Immunofluorescence: ROS Antibody - Staining of human cell line U...