anti-Ratte (Rattus) FGF21 Antikörper für Western Blotting

Recommended FGF21 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Fibroblast Growth Factor 21 (FGF21) Antikörper
  • FGF21
  • fibroblast growth factor 21
  • FGF21
  • fgf21
  • Fgf21
Epitop
N-Term
64
9
9
9
9
8
7
6
6
5
4
4
4
3
3
3
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
212
43
17
3
3
2
2
2
2
1
Wirt
Kaninchen
121
95
16
5
4
Klonalität
Polyklonal
Konjugat
Dieser FGF21 Antikörper ist unkonjugiert
13
13
7
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
179
109
63
60
27
20
19
9
8
3
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN634771
$ 510.36
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10 ABIN769002 IHC IHC (p) WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
7.8023243 ABIN2786170 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
7.8023243 ABIN3044256 WB Rabbit IgG AA 43-58, N-Term Anmelden zum Anzeigen Polyclonal 0
7.8023243 ABIN1867955 ICC IHC WB Rabbit IgG AA 25-208 Anmelden zum Anzeigen Polyclonal 0
7.8023243 ABIN2929263 IF/ICC IHC IP WB Rabbit AA 25-208 Anmelden zum Anzeigen Polyclonal 0
7.8023243 ABIN2929264 ELISA IF/ICC IHC WB Rabbit AA 29-207 Anmelden zum Anzeigen Polyclonal 0
4.8023243 ABIN3030935 WB Rabbit IgG AA 43-58 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2601959 WB Rabbit IgG AA 25-208 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2601972 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN2601956 WB Mouse IgG AA 1-209 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2532829 ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN6022986 IF/ICC IHC IP WB Mouse Anmelden zum Anzeigen 0

General

Antigen Fibroblast Growth Factor 21 (FGF21) Antikörper
Epitop N-Term
(64), (9), (9), (9), (9), (8), (7), (6), (6), (5), (4), (4), (4), (3), (3), (3), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(212), (43), (17), (3), (3), (2), (2), (2), (2), (1)
Wirt Kaninchen
(121), (95), (16), (5), (4)
Klonalität
Polyklonal
Konjugat Dieser FGF21 Antikörper ist unkonjugiert
(13), (13), (7), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(179), (109), (63), (60), (27), (20), (19), (9), (8), (3), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FGF21 Antikörper

Target Details FGF21 Anwendungsinformationen Handhabung Bilder
Spezifität FGF21 antibody was raised against the N terminal of FGF21
Reinigung Affinity purified
Immunogen FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT
Plasmids, Primers & others

Target Details FGF21

Produktdetails anti-FGF21 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung FGF21 (FGF21 Antibody Abstract)
Hintergrund FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.
Molekulargewicht 19 kDa (MW of target protein)
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-FGF21 Antikörper Target Details FGF21 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FGF21 Blocking Peptide, catalog no. 33R-2157, is also available for use as a blocking control in assays to test for specificity of this FGF21 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-FGF21 Antikörper Target Details FGF21 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF21 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.