anti-Human Ephrin B2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Ephrin B2 Antibody (geliefert von: Anmelden zum Anzeigen )

Ephrin B2 (EFNB2) Antikörper
  • EFNB2
  • efnb2
  • ephrin-B2
  • htkl
  • eplg5
  • htk-l
  • lerk5
  • ephrinB2
  • efnb2a
  • MGC68890
  • efnb2b
  • ELF-2
  • Epl5
  • Eplg5
  • Htk-L
  • LERK-5
  • Lerk5
  • NLERK-1
  • EPLG5
  • HTKL
  • LERK5
  • ephrin B2
  • ephrin-B2 precursor
  • ephrin B2 L homeolog
  • ephrin B2 S homeolog
  • EFNB2
  • efnb2
  • efnb2.L
  • efnb2.S
  • Efnb2
Dieser Ephrin B2 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4308730
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.624537 ABIN4308731 ICC IF IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN655599 IF IHC (p) WB Rabbit Ig Fraction AA 157-186, Center Anmelden zum Anzeigen Polyclonal 1
1 ABIN5556234 EIA IF IHC (p) WB Rabbit Ig Fraction AA 164-194, Middle Region Anmelden zum Anzeigen Polyclonal
1 ABIN5531138 IF IHC (p) WB Rabbit Ig Fraction AA 157-186 Anmelden zum Anzeigen Polyclonal
1 ABIN2962619 IF IHC (p) WB Rabbit AA 157-186 Anmelden zum Anzeigen Polyclonal
1 ABIN1978656 IF IHC (p) WB Rabbit AA 157-186 Anmelden zum Anzeigen Polyclonal


Antigen Ephrin B2 (EFNB2) Antikörper
Reaktivität Human
(99), (44), (26), (5), (5), (5), (3), (3), (3), (2), (2), (1), (1)
Wirt Kaninchen
(86), (16), (2)
Konjugat Dieser Ephrin B2 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(85), (37), (32), (25), (9), (7), (3), (2), (1), (1), (1)
Pubmed 3 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Ephrin B2 Antikörper

Target Details Ephrin B2 Anwendungsinformationen Handhabung Referenzen für anti-Ephrin B2 Antikörper (ABIN4308730) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Isotyp IgG

Target Details Ephrin B2

Produktdetails anti-Ephrin B2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-Ephrin B2 Antikörper (ABIN4308730) Bilder zurück nach oben
Andere Bezeichnung Ephrin B2 (EFNB2 Antibody Abstract)
Hintergrund Gene Symbol: EFNB2
Gen-ID 1948
Forschungsgebiet Neurology, Angiogenesis
Pathways RTK Signalweg, Regulation of Muscle Cell Differentiation


Produktdetails anti-Ephrin B2 Antikörper Target Details Ephrin B2 Handhabung Referenzen für anti-Ephrin B2 Antikörper (ABIN4308730) Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Ephrin B2 Antikörper Target Details Ephrin B2 Anwendungsinformationen Referenzen für anti-Ephrin B2 Antikörper (ABIN4308730) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-Ephrin B2 Antikörper (ABIN4308730)

Produktdetails anti-Ephrin B2 Antikörper Target Details Ephrin B2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Nakayama, Nakayama, van Lessen, Yamamoto, Hoffmann, Drexler, Itoh, Hirose, Breier, Vestweber, Cooper, Ohno, Kaibuchi, Adams: "Spatial regulation of VEGF receptor endocytosis in angiogenesis." in: Nature cell biology, Vol. 15, Issue 3, pp. 249-60, 2013

Nakayama, Nakayama, Turner, Höing, Lepore, Adams: "Ephrin-B2 controls PDGFR? internalization and signaling." in: Genes & development, Vol. 27, Issue 23, pp. 2576-89, 2013

Dravis, Henkemeyer: "Ephrin-B reverse signaling controls septation events at the embryonic midline through separate tyrosine phosphorylation-independent signaling avenues." in: Developmental biology, Vol. 355, Issue 1, pp. 138-51, 2011 (Probematerial (Species): Mouse (Murine)). Weitere Details: Western Blotting


Produktdetails anti-Ephrin B2 Antikörper Target Details Ephrin B2 Anwendungsinformationen Handhabung Referenzen für anti-Ephrin B2 Antikörper (ABIN4308730) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Western Blot: Ephrin B2 Antibody [NBP1-84830] - Lane 1: Marker [kDa] 230, 130, 95, 72...
Western Blotting (WB) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Western Blot: Ephrin B2 Antibody [NBP1-84830] - Lane 1: NIH-3T3 cell lysate (Mouse em...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunohistochemistry-Paraffin: Ephrin B2 Antibody [NBP1-84830] - Staining of human he...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunohistochemistry-Paraffin: Ephrin B2 Antibody - Staining of human kidney shows m...
Immunofluorescence (IF) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunocytochemistry/Immunofluorescence: Ephrin B2 Antibody - Staining of human cell ...