anti-Ratte (Rattus) ARPC1B Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended ARPC1B Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) Antikörper
  • ARC41
  • p40-ARC
  • p41-ARC
  • ARP2
  • cb871
  • arpc1a
  • fj15h02
  • zgc:64056
  • wu:fj08e12
  • wu:fj15h02
  • 41kDa
  • AA408064
  • AA408534
  • AA571392
  • AF007010
  • AW208418
  • L72
  • SOP2Hs
  • ACTIN-RELATED PROTEIN C1
  • ARPC1
  • F16D14.14
  • F16D14_14
  • actin-related protein C1B
  • arc41
  • p40-arc
  • p41-arc
  • actin related protein 2/3 complex subunit 1B
  • ARP2 actin related protein 2 homolog
  • actin related protein 2/3 complex, subunit 1B
  • ARP2/3 complex 41 kDa subunit
  • actin-related protein C1B
  • actin-related protein 2/3 complex subunit 1B
  • actin related protein 2/3 complex subunit 1B S homeolog
  • ARPC1B
  • ACTR2
  • Arpc1b
  • EHI_094120
  • arpc1b
  • LOC100410640
  • arpc1b.S
Reaktivität
Human, Maus, Ratte (Rattus)
64
20
16
7
7
5
4
3
3
2
1
1
1
1
Wirt
Kaninchen
46
18
Klonalität
Polyklonal
Konjugat
Dieser ARPC1B Antikörper ist unkonjugiert
4
4
4
3
3
3
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
55
41
16
12
4
2
2
2
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4278119
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.876529 ABIN351466 ELISA IHC IHC (p) WB Goat AA 2-14 Anmelden zum Anzeigen Polyclonal 0
1 ABIN372937 EIA IHC (p) WB Goat N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN1731962 IHC (p) ELISA WB Goat N-Term Anmelden zum Anzeigen Polyclonal 0

General

Antigen Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(64), (20), (16), (7), (7), (5), (4), (3), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(46), (18)
Klonalität
Polyklonal
Konjugat Dieser ARPC1B Antikörper ist unkonjugiert
(4), (4), (4), (3), (3), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(55), (41), (16), (12), (4), (2), (2), (2), (2)
Pubmed 2 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ARPC1B Antikörper

Target Details ARPC1B Anwendungsinformationen Handhabung Referenzen für anti-ARPC1B Antikörper (ABIN4278119) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Isotyp IgG
Plasmids, Primers & others

Target Details ARPC1B

Produktdetails anti-ARPC1B Antikörper Anwendungsinformationen Handhabung Referenzen für anti-ARPC1B Antikörper (ABIN4278119) Bilder zurück nach oben
Antigen
Andere Bezeichnung Actin-Related Protein 2/3 Complex Subunit 1B (ARPC1B Antibody Abstract)
Hintergrund Gene Symbol: ARPC1B
Molekulargewicht Theoretical MW: 41 kDa
Gen-ID 10095
UniProt O15143
Pathways RTK Signalweg, Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-ARPC1B Antikörper Target Details ARPC1B Handhabung Referenzen für anti-ARPC1B Antikörper (ABIN4278119) Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ARPC1B Antikörper Target Details ARPC1B Anwendungsinformationen Referenzen für anti-ARPC1B Antikörper (ABIN4278119) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-ARPC1B Antikörper (ABIN4278119)

Produktdetails anti-ARPC1B Antikörper Target Details ARPC1B Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Somech, Lev, Lee, Simon, Barel, Schiby, Avivi, Barshack, Rhodes, Yin, Wang, Yang, Rhodes, Marcus, Garty, Stein, Amariglio, Rechavi, Wiest, Zhang: "Disruption of Thrombocyte and T Lymphocyte Development by a Mutation inARPC1B." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 199, Issue 12, pp. 4036-4045, 2017 (Probematerial (Species): Human).

Abella, Galloni, Pernier, Barry, Kjær, Carlier, Way: "Isoform diversity in the Arp2/3 complex determines actin filament dynamics." in: Nature cell biology, Vol. 18, Issue 1, pp. 76-86, 2015 (Probematerial (Species): Human). Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence

Bilder

Produktdetails anti-ARPC1B Antikörper Target Details ARPC1B Anwendungsinformationen Handhabung Referenzen für anti-ARPC1B Antikörper (ABIN4278119) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - La...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Immunohistochemistry-Paraffin: actin-related protein 2/3 complex subunit 1B Antibody ...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody [NBP1-90114] - La...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in mo...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in hu...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in hu...
Western Blotting (WB) image for anti-Actin Related Protein 2/3 Complex, Subunit 1B, 41kDa (ARPC1B) antibody (ABIN4278119) Western Blot: actin-related protein 2/3 complex subunit 1B Antibody - Analysis in hu...