anti-Human ACTR3 Antikörper für Immunohistochemistry

Recommended ACTR3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antikörper
  • ARP3
  • 1200003A09Rik
  • Arp3
  • DDBDRAFT_0218534
  • DDBDRAFT_0219936
  • DDB_0218534
  • DDB_0219936
  • actr3
  • MGC53892
  • ACTR3
  • ARP3 actin related protein 3 homolog
  • ARP3 actin-related protein 3
  • actin-like protein 3
  • Actin-like protein 3
  • actin related protein 3
  • ARP3 actin-related protein 3 homolog S homeolog
  • ACTR3
  • Actr3
  • Tb09.160.3850
  • TVAG_371880
  • arpC
  • LOC100281262
  • actr3.S
  • actr3
Epitop
N-Term
10
6
4
3
2
2
2
2
2
2
2
1
1
1
1
Reaktivität
Human
60
28
21
3
3
3
3
2
2
2
2
1
1
1
1
Wirt
Kaninchen
48
12
Klonalität
Polyklonal
Konjugat
Dieser ACTR3 Antikörper ist unkonjugiert
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
55
32
23
11
9
8
4
3
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4890851
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.002499 ABIN5683018 ELISA FACS IHC WB Mouse IgG1 AA 287-418 Anmelden zum Anzeigen 3G2C9 0
9.002499 ABIN4278166 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2784770 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN1870794 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN4278164 IHC IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN3021339 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5683020 ELISA FACS ICC IF IHC WB Mouse IgG1 AA 287-418 Anmelden zum Anzeigen 3G2G1 0
1 ABIN5683019 ELISA FACS IHC WB Mouse IgG1 AA 287-418 Anmelden zum Anzeigen 3G2C9 0
1 ABIN5683021 ELISA FACS ICC IF IHC WB Mouse IgG1 AA 287-418 Anmelden zum Anzeigen 3G2G1 0
1 ABIN2888085 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN4278165 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1805648 FACS IHC IHC (p) WB Rabbit AA 380-407 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2893993 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN2693871 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5611287 ELISA ICC IHC WB Mouse IgG1 AA 287-418 Anmelden zum Anzeigen 3G2G1 0
1 ABIN5611286 ELISA FACS IHC WB Mouse IgG1 AA 287-418 Anmelden zum Anzeigen 3G2C9 0
1 ABIN5911854 ELISA IF/ICC IHC Rabbit IgG AA 352-409 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2925263 ELISA IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2195644 IF IHC ELISA WB Mouse IgG1 kappa AA 1-418 Anmelden zum Anzeigen 2B6 0
1 ABIN4252532 IHC WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0

General

Antigen ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antikörper
Epitop N-Term
(10), (6), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Reaktivität Human
(60), (28), (21), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(48), (12)
Klonalität
Polyklonal
Konjugat Dieser ACTR3 Antikörper ist unkonjugiert
(1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(55), (32), (23), (11), (9), (8), (4), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ACTR3 Antikörper

Target Details ACTR3 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen Synthetic peptides corresponding to ACTR3(ARP3 actin-related protein 3 homolog (yeast)) Antibody(against the N terminal of ACTR3 (NP_005712). Peptide sequence IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE.

Target Details ACTR3

Produktdetails anti-ACTR3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung ACTR3 (ACTR3 Antibody Abstract)
Hintergrund Gene Symbol: ACTR3
Molekulargewicht Theoretical MW: 47 kDa
Gen-ID 10096
UniProt P61158
Pathways RTK Signalweg, Regulation of Actin Filament Polymerization

Anwendungsinformationen

Produktdetails anti-ACTR3 Antikörper Target Details ACTR3 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 0.2-1 μg/mL, ImmunohistochemistryThis is a rabbit polyclonal antibody against ACTR3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ACTR3 Antikörper Target Details ACTR3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-ACTR3 Antikörper Target Details ACTR3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) (N-Term) antibody (ABIN4890851) Immunohistochemistry: ACTR3 Antibody [NBP1-56406] - Formalin Fixed Paraffin Embedded ...
Western Blotting (WB) image for anti-ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) (N-Term) antibody (ABIN4890851) Western Blot: ACTR3 Antibody [NBP1-56406] - Reccomended Titration: 0.2 - 1 ug/ml ELIS...