anti-Ratte (Rattus) CRY2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CRY2 Antibody (geliefert von: Anmelden zum Anzeigen )

Cryptochrome 2 (Photolyase-Like) (CRY2) Antikörper
  • Cry2
  • Cry
  • GB10211
  • CRY2
  • AT-PHH1
  • ATCRY2
  • F19P19.14
  • F19P19_14
  • FHA
  • PHH1
  • cryptochrome 2
  • HCRY2
  • PHLL2
  • AV006279
  • D130054K12Rik
  • gCry2
  • cryptochrome circadian regulator 2
  • cryptochrome 2
  • cryptochrome Cry2
  • cryptochrome circadian clock 2
  • cryptochrome 2 (photolyase-like)
  • CRY2
  • Cry2
  • cry2
  • LOC100502533
AA 171-200, N-Term
Human, Maus, Ratte (Rattus)
Dieser CRY2 Antikörper ist unkonjugiert
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN3042760
$ 280.00
Zzgl. Versandkosten $45.00


Antigen Cryptochrome 2 (Photolyase-Like) (CRY2) Antikörper
Epitop AA 171-200, N-Term
(23), (6), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(55), (26), (8), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(51), (9)
Konjugat Dieser CRY2 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(51), (30), (23), (12), (12), (3), (2), (2), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CRY2 Antikörper

Target Details CRY2 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cryptochrome circadian clock 2
Protein Name: Cryptochrome-2
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE), different from the related mouse and rat sequences by five amino acids.
Isotyp IgG

Target Details CRY2

Produktdetails anti-CRY2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung CRY2 (CRY2 Antibody Abstract)
Hintergrund This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: cry2 antibody|CRY2_HUMAN antibody|cryptochrome 2 (photolyase like) antibody|Cryptochrome 2 antibody|Cryptochrome-2 antibody|FLJ10332 antibody|growth inhibiting protein 37 antibody|HCRY2 antibody|KIAA0658 antibody|PHLL2 antibody|Photolyase like antibody
Gen-ID 1408
Forschungsgebiet Neurology
Pathways Response to Water Deprivation, Protein targeting to Nucleus


Produktdetails anti-CRY2 Antikörper Target Details CRY2 Handhabung Bilder zurück nach oben
Applikationshinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-CRY2 Antikörper Target Details CRY2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Produktdetails anti-CRY2 Antikörper Target Details CRY2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Cryptochrome 2 (Photolyase-Like) (CRY2) (AA 171-200), (N-Term) antibody (ABIN3042760) Anti- CRY2 Picoband antibody,IHC(P) IHC(P): Mouse Kidney Tissue
Immunohistochemistry (IHC) image for anti-Cryptochrome 2 (Photolyase-Like) (CRY2) (AA 171-200), (N-Term) antibody (ABIN3042760) Anti- CRY2 Picoband antibody,IHC(P) IHC(P): Rat Liver Tissue
Western Blotting (WB) image for anti-Cryptochrome 2 (Photolyase-Like) (CRY2) (AA 171-200), (N-Term) antibody (ABIN3042760) anti-Cryptochrome 2 (Photolyase-Like) (CRY2) (AA 171-200), (N-Term) antibody (Image 3)