anti-Zebrafisch (Danio rerio) TAR (HIV-1) RNA Binding Protein 2 Antikörper für Western Blotting

Recommended TAR (HIV-1) RNA Binding Protein 2 Antibody

TAR (HIV-1) RNA Binding Protein 2 (TARBP2) Antikörper
  • trbp
  • trbp1
  • trbp2
  • MGC97783
  • TARBP2
  • LOQS
  • TRBP
  • TRBP1
  • TRBP2
  • fj51e12
  • wu:fj51e12
  • zgc:63778
  • Prbp
  • TAR (HIV-1) RNA binding protein 2
  • TARBP2, RISC loading complex RNA binding subunit
  • TAR (HIV-1) RNA binding protein 2 L homeolog
  • TAR (HIV) RNA binding protein 2
  • tarbp2
  • TARBP2
  • tarbp2.L
  • Tarbp2
Human, Maus, Ratte (Rattus), Zebrafisch (Danio rerio)
Western Blotting (WB)


Produktnummer ABIN629947
$ 369.29
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Clonality References Details
7 ABIN290382 IHC IHC (p) WB Rabbit AA 150-200 Polyclonal 0
4.8906236 ABIN2778885 WB Rabbit N-Term Polyclonal 1
4.8906236 ABIN2462162 ELISA WB Rabbit Polyclonal 0
4 ABIN203249 WB Rabbit IgG AA 25-74 Polyclonal 0
4 ABIN372447 IHC (p) WB Rabbit IgG AA 150-200 Polyclonal 0
4 ABIN2470147 IHC WB Rabbit AA 150-200 Polyclonal 0
4 ABIN1739906 IHC (p) WB Rabbit IgG AA 150-200 Polyclonal 0
1 ABIN537303 WB Rabbit Polyclonal 0


Antigen TAR (HIV-1) RNA Binding Protein 2 (TARBP2) Antikörper
Reaktivität Human, Maus, Ratte (Rattus), Zebrafisch (Danio rerio)
(73), (22), (16), (8), (7), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(54), (19)
Konjugat Unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Western Blotting (WB)
(71), (38), (30), (11), (6), (5), (2), (1), (1)


Antigendetails Anwendungsinformationen Handhabung Bilder
Reinigung Purified
Immunogen TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung TARBP2 (TARBP2 Antibody Abstract)
Hintergrund HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein.
Molekulargewicht 8 kDa (MW of target protein)
Pathways Regulatorische RNA Pathways, Ribonucleoprotein Complex Subunit Organization


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

TARBP2 Blocking Peptide, catalog no. 33R-1405, is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARBP2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-TAR (HIV-1) RNA Binding Protein 2 (TARBP2) antibody (ABIN629947) TARBP2 antibody used at 2.5 ug/ml to detect target protein.