anti-Maus CLOCK Antikörper für Western Blotting

Recommended CLOCK Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Clock Homolog (Mouse) (CLOCK) Antikörper
  • CG7391
  • CLK
  • CLOCK
  • Dmel\\CG7391
  • Jerk
  • Jrk
  • PAS1
  • bHLHe10
  • clk
  • clock
  • dCLK
  • dCLK/JRK
  • dCLOCK
  • dClck
  • dClk
  • dClock
  • dclk
  • jrk
  • Xclk
  • XClock
  • zCLOCK1
  • zfCLOCK1
  • 5330400M04Rik
  • KAT13D
  • bHLHe8
  • mKIAA0334
  • Clock
  • clock circadian regulator
  • clock homolog (mouse)
  • clock circadian regulator a
  • circadian locomotor output cycles kaput
  • clock circadian regulator L homeolog
  • Clk
  • CLOCK
  • clock
  • clocka
  • Clock
  • clock.L
Epitop
AA 75-109, N-Term
19
7
7
5
5
4
4
3
2
2
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
105
46
31
5
5
4
4
3
3
3
3
2
2
1
1
1
Wirt
Kaninchen
66
38
13
1
Klonalität
Polyklonal
Konjugat
Dieser CLOCK Antikörper ist unkonjugiert
2
2
2
1
1
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
107
57
42
19
15
12
10
5
4
3
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043813
$ 280.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
19.558455 ABIN2855356 ICC IF WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
16.558455 ABIN1589996 ELISA WB Goat Internal Region Anmelden zum Anzeigen Polyclonal 0
16.558455 ABIN3183967 ELISA IHC WB Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal 0
13.8047 ABIN6260894 ELISA ICC IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
13.8047 ABIN6260895 ELISA ICC IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
12.753754 ABIN2137798 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.8047 ABIN2705900 IHC WB Rabbit Center Anmelden zum Anzeigen Polyclonal 0
7.8047 ABIN1533501 IHC ELISA WB Rabbit IgG AA 241-290 Anmelden zum Anzeigen Polyclonal 1
7.8047 ABIN1848962 IHC ELISA WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
7 ABIN2889318 ELISA IHC IHC (p) WB Rabbit IgG AA 241-290 Anmelden zum Anzeigen Polyclonal 0
7 ABIN962571 IHC IHC (p) IP WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7 ABIN272135 IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0
7 ABIN1575729 IHC ELISA WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
4.8047 ABIN2778091 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.8047 ABIN411452 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.8047 ABIN5959221 ELISA IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.8047 ABIN5897432 ELISA IHC WB Goat AA 458-472 Anmelden zum Anzeigen Polyclonal 0
4.8047 ABIN2561905 ELISA WB Goat IgG AA 458-472 Anmelden zum Anzeigen Polyclonal 0
4 ABIN467909 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
4 ABIN790960 ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Clock Homolog (Mouse) (CLOCK) Antikörper
Epitop AA 75-109, N-Term
(19), (7), (7), (5), (5), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(105), (46), (31), (5), (5), (4), (4), (3), (3), (3), (3), (2), (2), (1), (1), (1)
Wirt Kaninchen
(66), (38), (13), (1)
Klonalität
Polyklonal
Konjugat Dieser CLOCK Antikörper ist unkonjugiert
(2), (2), (2), (1), (1), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(107), (57), (42), (19), (15), (12), (10), (5), (4), (3), (2), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CLOCK Antikörper

Target Details CLOCK Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Circadian locomoter output cycles protein kaput(CLOCK) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequenz QKSIDFLRKH KEITAQSDAS EIRQDWKPTF LSNEE
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Circadian locomoter output cycles protein kaput(CLOCK) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: clock circadian regulator
Protein Name: Circadian locomoter output cycles protein kaput
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human KAT13D/CLOCK (75-109aa QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE) , different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Isotyp IgG
Plasmids, Primers & others

Target Details CLOCK

Produktdetails anti-CLOCK Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CLOCK (CLOCK Antibody Abstract)
Hintergrund Clock (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome. Alternative splicing results in multiple transcript variants.

Synonyms: bHLHe8 antibody|Circadian locomoter output cycles kaput protein antibody|Circadian locomoter output cycles protein kaput antibody| Circadian Locomotor Output Cycles Kaput antibody|Circadium Locomotor Output Cycles Kaput antibody|Class E basic helix-loop-helix protein 8 antibody|CLOCK antibody|Clock circadian regulator antibody|Clock homolog antibody|Clock protein antibody|CLOCK_HUMAN antibody|hCLOCK antibody|KIAA0334 antibody
Gen-ID 9575
UniProt O15516
Pathways Regulation of Lipid Metabolism by PPARalpha, Photoperiodism

Anwendungsinformationen

Produktdetails anti-CLOCK Antikörper Target Details CLOCK Handhabung Bilder zurück nach oben
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CLOCK Antikörper Target Details CLOCK Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-CLOCK Antikörper Target Details CLOCK Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody
Immunohistochemistry (IHC) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) Anti- KAT13D/CLOCK antibody, IHC(P) IHC(P): Human Intestinal Cancer Tissue
Immunohistochemistry (IHC) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) Anti- KAT13D/CLOCK antibody, IHC(P) IHC(P): Mouse Skeletal Muscle Tissue
Immunohistochemistry (IHC) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) Anti- KAT13D/CLOCK antibody, IHC(P) IHC(P): Rat Testis Tissue
Immunohistochemistry (IHC) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) IHC analysis of CLOCK using anti-CLOCK antibody . CLOCK was detected in immunocytoche...
Immunohistochemistry (IHC) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) IHC analysis of CLOCK using anti-CLOCK antibody . CLOCK was detected in immunocytoche...
Immunohistochemistry (IHC) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) IHC analysis of CLOCK using anti-CLOCK antibody . CLOCK was detected in immunocytoche...
Immunohistochemistry (IHC) image for anti-Clock Homolog (Mouse) (CLOCK) (AA 75-109), (N-Term) antibody (ABIN3043813) IHC analysis of CLOCK using anti-CLOCK antibody . CLOCK was detected in frozen sectio...