anti-Human TAP2 Antikörper für Immunocytochemistry

Recommended TAP2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2) Antikörper
  • ABC18
  • ABCB3
  • APT2
  • D6S217E
  • PSF-2
  • PSF2
  • RING11
  • AI462429
  • Abcb3
  • Ham-2
  • Ham2
  • MTP2
  • Tap-2
  • Y1
  • jas
  • Cim
  • transporter 2, ATP binding cassette subfamily B member
  • transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
  • TAP2
  • Tap2
Reaktivität
Human
87
42
41
Wirt
Kaninchen
83
3
2
Klonalität
Polyklonal
Konjugat
Dieser TAP2 Antikörper ist unkonjugiert
5
5
5
3
2
2
2
2
2
2
2
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
40
34
26
26
17
15
5
3
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Produktnummer ABIN4357821
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN4348150 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5013138 ICC IHC WB Rabbit IgG AA 468-686 Anmelden zum Anzeigen Polyclonal 0

General

Antigen Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2) Antikörper
Reaktivität Human
(87), (42), (41)
Wirt Kaninchen
(83), (3), (2)
Klonalität
Polyklonal
Konjugat Dieser TAP2 Antikörper ist unkonjugiert
(5), (5), (5), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(40), (34), (26), (26), (17), (15), (5), (3), (3), (1), (1), (1)
Pubmed 2 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-TAP2 Antikörper

Target Details TAP2 Anwendungsinformationen Handhabung Referenzen für anti-TAP2 Antikörper (ABIN4357821) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQA
Isotyp IgG

Target Details TAP2

Produktdetails anti-TAP2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-TAP2 Antikörper (ABIN4357821) Bilder zurück nach oben
Antigen
Andere Bezeichnung TAP2 (TAP2 Antibody Abstract)
Hintergrund Gene Symbol: TAP2
Gen-ID 6891
Pathways Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process

Anwendungsinformationen

Produktdetails anti-TAP2 Antikörper Target Details TAP2 Handhabung Referenzen für anti-TAP2 Antikörper (ABIN4357821) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-TAP2 Antikörper Target Details TAP2 Anwendungsinformationen Referenzen für anti-TAP2 Antikörper (ABIN4357821) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-TAP2 Antikörper (ABIN4357821)

Produktdetails anti-TAP2 Antikörper Target Details TAP2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Feigenberg, Clarke, Virtanen, Plotkin, Letarte, Rosen, Bernardini, Kollara, Brown, Murphy: "Molecular profiling and clinical outcome of high-grade serous ovarian cancer presenting with low- versus high-volume ascites." in: BioMed research international, Vol. 2014, pp. 367103, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013