anti-Human BMP6 Antikörper für Immunofluorescence

Recommended BMP6 Antibody (geliefert von: Anmelden zum Anzeigen )

Bone Morphogenetic Protein 6 (BMP6) Antikörper
  • BMP6
  • zgc:113595
  • vgr
  • vgr-1
  • vgr1
  • VGR
  • VGR1
  • D13Wsu115e
  • Vgr1
  • bone morphogenetic protein 6
  • bone morphogenetic protein 6 S homeolog
  • BMP6
  • bmp6
  • bmp6.S
  • Bmp6
Dieser BMP6 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5075308
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1173353 ICC IF IHC WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal 0


Antigen Bone Morphogenetic Protein 6 (BMP6) Antikörper
Reaktivität Human
(107), (30), (21), (3), (2), (2), (2), (2), (2), (2), (2), (1)
Wirt Kaninchen
(96), (25)
Konjugat Dieser BMP6 Antikörper ist unkonjugiert
(14), (10), (6), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(104), (67), (49), (16), (9), (6), (3), (2), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-BMP6 Antikörper

Target Details BMP6 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY
Isotyp IgG
Plasmids, Primers & others

Target Details BMP6

Produktdetails anti-BMP6 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung BMP-6 (BMP6 Antibody Abstract)
Hintergrund Gene Symbol: BMP6
Gen-ID 654
Pathways Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process


Produktdetails anti-BMP6 Antikörper Target Details BMP6 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-BMP6 Antikörper Target Details BMP6 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-BMP6 Antikörper Target Details BMP6 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Bone Morphogenetic Protein 6 (BMP6) antibody (ABIN5075308) Immunocytochemistry/Immunofluorescence: BMP-6 Antibody - Staining of human cell line...