anti-Human FHOD3 Antikörper für Western Blotting

Recommended FHOD3 Antibody (geliefert von: Anmelden zum Anzeigen )

Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
  • FHOS2
  • Formactin2
  • A930009H06Rik
  • mKIAA1695
  • formin homology 2 domain containing 3b
  • formin homology 2 domain containing 3
  • fhod3b
  • FHOD3
  • Fhod3
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN630729
$ 473.93
Zzgl. Versandkosten $45.00


Antigen Formin Homology 2 Domain Containing 3 (FHOD3) Antikörper
Epitop C-Term
Reaktivität Human
(8), (3), (3), (3), (3), (3), (3)
Wirt Kaninchen
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(7), (3), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-FHOD3 Antikörper

Target Details FHOD3 Anwendungsinformationen Handhabung Bilder
Spezifität FHOD3 antibody was raised against the C terminal of FHOD3
Reinigung Affinity purified
Immunogen FHOD3 antibody was raised using the C terminal of FHOD3 corresponding to a region with amino acids SGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPALGV

Target Details FHOD3

Produktdetails anti-FHOD3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung FHOD3 (FHOD3 Antibody Abstract)
Hintergrund Proteins that contain formin homology (FH) domains, such as FHOD3, play a role in regulation of the actin cytoskeleton.
Molekulargewicht 60 kDa (MW of target protein)
Forschungsgebiet Cell Biology
Pathways Regulation of Actin Filament Polymerization


Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Handhabung Bilder zurück nach oben
Applikationshinweise WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

FHOD3 Blocking Peptide, catalog no. 33R-8468, is also available for use as a blocking control in assays to test for specificity of this FHOD3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FHOD3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Produktdetails anti-FHOD3 Antikörper Target Details FHOD3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) antibody (ABIN630729) FHOD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Immunohistochemistry (IHC) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) antibody (ABIN630729) FHOD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Mag...
Western Blotting (WB) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) (C-Term) antibody (ABIN630729) FHOD3 antibody used at 1 ug/ml to detect target protein.