anti-Human CDC42 Effector Protein (Rho GTPase Binding) 2 Antikörper für Immunocytochemistry

Recommended CDC42 Effector Protein (Rho GTPase Binding) 2 Antibody (geliefert von: Anmelden zum Anzeigen )

CDC42 Effector Protein (Rho GTPase Binding) 2 (CDC42EP2) Antikörper
  • CDC42EP2
  • zgc:103557
  • BORG1
  • CEP2
  • 1110008C05Rik
  • Borg1
  • Cep2
  • D19Bwg1013e
  • CDC42 effector protein 2
  • CDC42 effector protein 2 S homeolog
  • CDC42 effector protein (Rho GTPase binding) 2
  • CDC42EP2
  • cdc42ep2.S
  • cdc42ep2
  • Cdc42ep2
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4296956
Preis und Verfügbarkeit auf Anfrage.


Antigen CDC42 Effector Protein (Rho GTPase Binding) 2 (CDC42EP2) Antikörper
Reaktivität Human
(45), (30), (15), (3)
Wirt Kaninchen
(41), (5)
Konjugat Unkonjugiert
(2), (2), (2), (2), (2), (2)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(44), (28), (4), (3)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQI
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung CDC42EP2 (CDC42EP2 Antibody Abstract)
Hintergrund Gene Symbol: CDC42EP2
Gen-ID 10435
Forschungsgebiet Signaling, Microfilaments, Cytoskeleton
Pathways Regulation of Actin Filament Polymerization


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CDC42 Effector Protein (Rho GTPase Binding) 2 (CDC42EP2) antibody (ABIN4296956) Immunohistochemistry-Paraffin: CDC42EP2 Antibody [NBP1-88383] - Staining of human sto...
Immunofluorescence (IF) image for anti-CDC42 Effector Protein (Rho GTPase Binding) 2 (CDC42EP2) antibody (ABIN4296956) Immunocytochemistry/Immunofluorescence: CDC42EP2 Antibody [NBP1-88383] - Staining of ...
Western Blotting (WB) image for anti-CDC42 Effector Protein (Rho GTPase Binding) 2 (CDC42EP2) antibody (ABIN4296956) Western Blot: CDC42EP2 Antibody [NBP1-88383] - Lane 1: Marker [kDa] 250, 130, 95, 72,...
Immunofluorescence (IF) image for anti-CDC42 Effector Protein (Rho GTPase Binding) 2 (CDC42EP2) antibody (ABIN4296956) Immunocytochemistry/Immunofluorescence: CDC42EP2 Antibody - Immunofluorescent staini...