GFP Protein (AA 1-238) (His tag)
-
- Target Alle GFP Proteine anzeigen
- GFP (Green Fluorescent Protein (GFP))
- Protein-Typ
- Recombinant
- Proteineigenschaft
- AA 1-238
-
Spezies
- Diverse Spezies
-
Quelle
- Escherichia coli (E. coli)
- Aufreinigungstag / Konjugat
- Dieses GFP Protein ist gelabelt mit His tag.
- Applikation
- SDS-PAGE (SDS), Western Blotting (WB), Positive Control (PC), Immunogen (Imm)
- Sequenz
- S-Met1-Lys238-TRTRPLEQKL ISEEDLAAND ILDYKDDDDK V
- Produktmerkmale
- Recombinant Green Fluorescent Protein (GFP), Prokaryotic expression, S-Met1-Lys238myc-FLAG tag, N-terminal His Tag
- Reinheit
- > 90 %
- Top Product
- Discover our top product GFP Protein
-
Green Fluorescent Protein (GFP) protein
GFP Spezies: Aequorea victoria Recombinant Ct, IA
Green Fluorescent Protein (GFP) protein (His tag)GFP Spezies: Aequorea victoria Wirt: Escherichia coli (E. coli) Recombinant > 90 % as determined by SDS-PAGE
Green Fluorescent Protein (GFP) (AA 1-238) protein (His tag)GFP Spezies: General Wirt: Hefe Recombinant > 95 % SDS, WB, ELISA, IP
Green Fluorescent Protein (GFP) protein (His tag)GFP Spezies: E. coli Wirt: Escherichia coli (E. coli) Recombinant > 80 % as determined by SDS-PAGE and Coomassie blue staining AbP, STD
Green Fluorescent Protein (GFP) (AA 1-238), (full length) protein (His-SUMO Tag)GFP Spezies: Aequorea victoria Wirt: Escherichia coli (E. coli) Recombinant > 90 % SDS
Green Fluorescent Protein (GFP) (AA 1-238), (full length) protein (His tag)GFP Spezies: Aequorea victoria Wirt: Hefe Recombinant > 90 % SDS
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Isoelectric Point:5.1
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- PBS, pH7.4, containing 20% Glycerine
- Lagerung
- 4 °C,-80 °C
- Informationen zur Lagerung
- Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
- Haltbarkeit
- 12 months
-
- Target
- GFP (Green Fluorescent Protein (GFP))
- Andere Bezeichnung
- Green Fluorescent Protein (GFP Produkte)
- Synonyme
- green fluorescent protein Protein, gfp Protein
- Substanzklasse
- Viral Protein
- Molekulargewicht
- 37kDa
-
