Cadherin 7 Protein (CDH7) (AA 48-607)
-
- Target Alle Cadherin 7 (CDH7) Proteine anzeigen
- Cadherin 7 (CDH7)
- Protein-Typ
- Recombinant
- Proteineigenschaft
- AA 48-607
-
Spezies
- Human
-
Quelle
- Insektenzellen
- Applikation
- Western Blotting (WB), SDS-PAGE (SDS), ELISA, Crystallization (Crys)
- Sequenz
-
SAAASWVWNQFFVLEEYMGSDPLYVGKLHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHAT
KRLDREEQAYYTLRAQALDRLTNKPVEPESEFVIKIQDINDNEPKFLDGPYTAGVPEMSP
VGTSVVQVTATDADDPTYGNSARVVYSILQGQPYFSVEPKTGVIKTALPNMDREAKDQYL
LVIQAKDMVGQNGGLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPVASVVARIKAA
DADIGANAEMEYKIVDGDGLGIFKISVDKETQEGIITIQKELDFEAKTSYTLRIEAANKD
ADPRFLSLGPFSDTTTVKIIVEDVDEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPDSS
NSPVRYSIDRNTDLERYFNIDANSGVITTAKSLDRETNAIHNITVLAMESQNPSQVGRGY
VAITILDINDNAPEFAMDYETTVCENAQPGQVIQKISAVDKDEPSNGHQFYFSLTTDATN
NHNFSLKDNKDNTASILTRRNGFRRQEQSVYYLPIFIVDSGSPSLSSTNTLTIRVCDCDA
DGVAQTCNAEAYVLPAGLST
Sequence without tag. Tag location is at the discretion of the manufacturer. If you have a special request, please contact us. - Produktmerkmale
-
- Made in Germany - from design to production - by highly experienced protein experts.
- Human CDH7 Protein (raised in Insect Cells) purified by multi-step, protein-specific process to ensure crystallization grade.
- State-of-the-art algorithm used for plasmid design (Gene synthesis).
This protein is a made to order protein and will be made for the first time for your order. Our experts in the lab will ensure that you receive a correctly folded protein.
The big advantage of ordering our made-to-order proteins in comparison to ordering custom made proteins from other companies is that there is no financial obligation in case the protein cannot be expressed or purified.
In the unlikely event that the protein cannot be expressed or purified we do not charge anything (other companies might charge you for any performed steps in the expression process for custom-made proteins, e.g. fees might apply for the expression plasmid, the first expression experiments or purification optimization).
When you order this made-to-order protein you will only pay upon receival of the correctly folded protein. With no financial risk on your end you can rest assured that our experienced protein experts will do everything to make sure that you receive the protein you ordered.
The concentration of our recombinant proteins is measured using the absorbance at 280nm. The protein's absorbance will be measured in several dilutions and is measured against its specific reference buffer.
The concentration of the protein is calculated using its specific absorption coefficient. We use the Expasy's protparam tool to determine the absorption coefficient of each protein.
- Aufreinigung
-
Three step purification of membrane proteins expressed in baculovirus infected SF9 insect cells:
- Membrane proteins are fractioned by ultracentrifugation and subsequently solubilized with different detergents (detergent screen). Samples are analyzed by Western blot.
- Reinheit
- >95 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot.
- Sterilität
- 0.22 μm filtered
- Endotoxin-Niveau
- Protein is endotoxin-free.
- Güteklasse
- Crystallography grade
- Top Product
- Discover our top product CDH7 Protein
-
-
- Applikationshinweise
- In addition to the applications listed above we expect the protein to work for functional studies as well. As the protein has not been tested for functional studies yet we cannot offer a gurantee though.
- Kommentare
-
In cases in which it is highly likely that the recombinant protein with the default tag will be insoluble our protein lab may suggest a higher molecular weight tag (e.g. GST-tag) instead to increase solubility. We will discuss all possible options with you in detail to assure that you receive your protein of interest.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- 100 mM NaCL, 20 mM Hepes, 10% glycerol. pH value is at the discretion of the manufacturer.
- Handhabung
- Avoid repeated freeze-thaw cycles.
- Lagerung
- -80 °C
- Informationen zur Lagerung
- Store at -80°C.
- Haltbarkeit
- Unlimited (if stored properly)
-
- Target
- Cadherin 7 (CDH7)
- Andere Bezeichnung
- CDH7 (CDH7 Produkte)
- Synonyme
- CDH7L1 Protein, Cad7 Protein, 9330156F07Rik Protein, cadherin 7 Protein, cadherin 7, type 2 Protein, cadherin 7a Protein, CDH7 Protein, Cdh7 Protein, cdh7a Protein
- Hintergrund
- Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types.
- Molekulargewicht
- 64.7 kDa Including tag.
- UniProt
- Q9ULB5
- Pathways
- Cell-Cell Junction Organization
-