AP2S1 Protein (AA 1-142, full length) (GST tag)

Produktnummer ABIN1046568

Produktdetails

Target: AP2S1 (Adaptor-Related Protein Complex 2, sigma 1 Subunit (AP2S1))

Protein-Typ: Recombinant

Proteineigenschaft: AA 1-142, full length

Spezies: Human

Quelle: Escherichia coli (E. coli)

Aufreinigungstag / Konjugat: Dieses AP2S1 Protein ist gelabelt mit GST tag.

Applikation: ELISA

Sequenz: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVT VRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAY LEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA GEIRETSQTKVLKQLLMLQSLE

Produktmerkmale: Please inquire if you are interested in this recombinant protein expressed in E. coli, mammalien cells or by baculovirus infection. Be aware about differences in price and lead time.

Reinheit: 90 %

Anwendungsinformationen

Kommentare:

The yeast protein expression system is the most economical and efficient eukaryotic system for secretion and intracellular expression. A protein expressed by the mammalian cell system is of very high-quality and close to the natural protein. But the low expression level, the high cost of medium and the culture conditions restrict the promotion of mammalian cell expression systems. The yeast protein expression system serve as a eukaryotic system integrate the advantages of the mammalian cell expression system. A protein expressed by yeast system could be modificated such as glycosylation, acylation, phosphorylation and so on to ensure the native protein conformation. It can be used to produce protein material with high added value that is very close to the natural protein. Our proteins produced by yeast expression system has been used as raw materials for downstream preparation of monoclonal antibodies.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Konzentration: 0.2-2 mg/mL

Buffer: Tris-based buffer, 50 % glycerol

Handhabung: Repeated freezing and thawing is not recommended. Store working aliquots at 4 °C for up to one week

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20 °C for extended storage, conserve at -20 °C or -80 °C

Referenzen

Holzmann, Pöltl, Sauermann: "A novel spliced transcript of human CLAPS2 encoding a protein alternative to clathrin adaptor protein AP17." in: Gene, Vol. 220, Issue 1-2, pp. 39-44, (1998) (PubMed).

Winterpacht, Endele, Enklaar, Fuhry, Zabel: "Human CLAPS2 encoding AP17, a small chain of the clathrin-associated protein complex: cDNA cloning and chromosomal assignment to 19q13.2-->q13.3." in: Cytogenetics and cell genetics, Vol. 75, Issue 2-3, pp. 132-5, (1997) (PubMed).

Antigendetails

Target: AP2S1 (Adaptor-Related Protein Complex 2, sigma 1 Subunit (AP2S1))

Andere Bezeichnung: AP-2 complex subunit sigma protein (AP2S1 Produkte)

Synonyme: AP2S1 Protein, ap17 Protein, claps2 Protein, ap17-delta Protein, DDBDRAFT_0188542 Protein, DDBDRAFT_0234236 Protein, DDB_0188542 Protein, DDB_0234236 Protein, MGC85224 Protein, AP17 Protein, AP17-DELTA Protein, CLAPS2 Protein, HHC3 Protein, AI043088 Protein, Ap17 Protein, adaptor related protein complex 2 sigma 1 subunit Protein, adaptor-related protein complex 2, sigma 1 subunit Protein, adaptor related protein complex 2 sigma 1 subunit S homeolog Protein, AP2S1 Protein, ap2s1 Protein, ap2s1.S Protein, Ap2s1 Protein

Hintergrund: Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein Transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif.

Molekulargewicht: 44.4 kD

UniProt: P53680

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, EGFR Downregulation