anti-Human CCL19 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended CCL19 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Chemokine (C-C Motif) Ligand 19 (CCL19) Antikörper
  • CKb11
  • ELC
  • MIP-3b
  • MIP3B
  • SCYA19
  • CCL19
  • Scya19
  • exodus-3
  • C-C motif chemokine ligand 19
  • chemokine (C-C motif) ligand 19
  • CCL19
  • ccl19
  • Ccl19
Reaktivität
Human
129
34
22
2
Wirt
Kaninchen
78
62
15
Klonalität
Polyklonal
Konjugat
Dieser CCL19 Antikörper ist unkonjugiert
15
9
8
6
5
5
5
5
4
4
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
84
71
67
23
17
15
13
6
5
5
5
4
3
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5075558
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.828831 ABIN4288750 IHC IHC (fro) IHC (p) WB Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN740505 IF (p) IHC (p) Rabbit IgG AA 60-100 Anmelden zum Anzeigen Polyclonal 1
1 ABIN1499472 IHC (p) ELISA WB Mouse kappa, IgG1 Anmelden zum Anzeigen 0
1 ABIN740514 IHC (p) HRP Rabbit IgG AA 60-100 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2618135 IHC (p) Mouse IgG1 AA 22-98 Anmelden zum Anzeigen 4F3 0
1 ABIN2618133 IHC (p) Mouse IgG1 AA 22-98 Anmelden zum Anzeigen 2A12 0
1 ABIN740507 IHC (p) Biotin Rabbit IgG AA 60-100 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5600726 IHC IHC (fro) IHC (p) WB Alexa Fluor 405 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600729 IHC IHC (fro) IHC (p) WB Alexa Fluor 700 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600733 IHC IHC (fro) IHC (p) WB DyLight 488 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600737 IHC IHC (fro) IHC (p) WB DyLight 755 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600735 IHC IHC (fro) IHC (p) WB DyLight 650 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600738 IHC IHC (fro) IHC (p) FITC Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600727 IHC IHC (fro) IHC (p) WB Alexa Fluor 488 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600728 IHC IHC (fro) IHC (p) WB Alexa Fluor 647 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600730 IHC IHC (fro) IHC (p) WB Biotin Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600731 IHC IHC (fro) IHC (p) WB DyLight 350 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600732 IHC IHC (fro) IHC (p) WB DyLight 405 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600734 IHC IHC (fro) IHC (p) WB DyLight 550 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0
1 ABIN5600736 IHC IHC (fro) IHC (p) WB DyLight 680 Mouse IgG2 Anmelden zum Anzeigen MM0143-11B4 0

General

Antigen Chemokine (C-C Motif) Ligand 19 (CCL19) Antikörper
Reaktivität Human
(129), (34), (22), (2)
Wirt Kaninchen
(78), (62), (15)
Klonalität
Polyklonal
Konjugat Dieser CCL19 Antikörper ist unkonjugiert
(15), (9), (8), (6), (5), (5), (5), (5), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(84), (71), (67), (23), (17), (15), (13), (6), (5), (5), (5), (4), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CCL19 Antikörper

Target Details CCL19 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Isotyp IgG

Target Details CCL19

Produktdetails anti-CCL19 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CCL19/MIP-3 beta (CCL19 Antibody Abstract)
Hintergrund Gene Symbol: CCL19
Gen-ID 6363
Pathways Positive Regulation of Immune Effector Process

Anwendungsinformationen

Produktdetails anti-CCL19 Antikörper Target Details CCL19 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CCL19 Antikörper Target Details CCL19 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CCL19 Antikörper Target Details CCL19 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunocytochemistry/Immunofluorescence: CCL19/MIP-3 beta Antibody - Immunohistochemi...
Immunohistochemistry (IHC) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunohistochemistry: CCL19/MIP-3 beta Antibody - Immunohistochemical staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody - Staining of human cerebra...