anti-Human CCL19 Antikörper für Immunofluorescence

Recommended CCL19 Antibody (geliefert von: Anmelden zum Anzeigen )

Chemokine (C-C Motif) Ligand 19 (CCL19) Antikörper
  • CKb11
  • ELC
  • MIP-3b
  • MIP3B
  • SCYA19
  • CCL19
  • Scya19
  • exodus-3
  • C-C motif chemokine ligand 19
  • chemokine (C-C motif) ligand 19
  • CCL19
  • ccl19
  • Ccl19
Dieser CCL19 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5075558
Preis und Verfügbarkeit auf Anfrage.


Antigen Chemokine (C-C Motif) Ligand 19 (CCL19) Antikörper
Reaktivität Human
(129), (34), (22), (2)
Wirt Kaninchen
(78), (62), (15)
Konjugat Dieser CCL19 Antikörper ist unkonjugiert
(15), (9), (8), (6), (5), (5), (5), (5), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(84), (71), (67), (23), (17), (15), (13), (6), (5), (5), (5), (4), (3), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CCL19 Antikörper

Target Details CCL19 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Isotyp IgG

Target Details CCL19

Produktdetails anti-CCL19 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung CCL19/MIP-3 beta (CCL19 Antibody Abstract)
Hintergrund Gene Symbol: CCL19
Gen-ID 6363
Pathways Positive Regulation of Immune Effector Process


Produktdetails anti-CCL19 Antikörper Target Details CCL19 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-CCL19 Antikörper Target Details CCL19 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-CCL19 Antikörper Target Details CCL19 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunocytochemistry/Immunofluorescence: CCL19/MIP-3 beta Antibody - Immunohistochemi...
Immunohistochemistry (IHC) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunohistochemistry: CCL19/MIP-3 beta Antibody - Immunohistochemical staining of hu...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Chemokine (C-C Motif) Ligand 19 (CCL19) antibody (ABIN5075558) Immunohistochemistry-Paraffin: CCL19/MIP-3 beta Antibody - Staining of human cerebra...