anti-Human CARD8 Antikörper für Immunohistochemistry

Recommended CARD8 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Caspase Recruitment Domain Family, Member 8 (CARD8) Antikörper
  • CARD8
  • CARDINAL
  • DACAR
  • DAKAR
  • NDPP
  • NDPP1
  • TUCAN
  • caspase recruitment domain family, member 8
  • caspase recruitment domain-containing protein 8
  • caspase recruitment domain family member 8
  • CARD8
  • LOC718594
Reaktivität
Human
81
11
10
Wirt
Kaninchen
72
9
Klonalität
Polyklonal
Konjugat
Dieser CARD8 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
61
26
17
16
14
13
13
13
5
4
2
2
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4287924
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.385681 ABIN4287925 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.385681 ABIN2429687 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.385681 ABIN2423061 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1871444 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN3020898 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4287922 ELISA ICC IF IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN4287921 IHC IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN4287919 IHC IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2218500 IP IHC WB Rabbit IgG AA 125-146 Anmelden zum Anzeigen Polyclonal
1 ABIN2403584 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2218499 IP IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2882012 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1083891 IF IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1083892 IF IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2218497 IC IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2893907 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2694783 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4287918 IHC IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN4287920 IHC IHC (p) IP WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN2988649 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Caspase Recruitment Domain Family, Member 8 (CARD8) Antikörper
Reaktivität Human
(81), (11), (10)
Wirt Kaninchen
(72), (9)
Klonalität
Polyklonal
Konjugat Dieser CARD8 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(61), (26), (17), (16), (14), (13), (13), (13), (5), (4), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CARD8 Antikörper

Target Details CARD8 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA
Isotyp IgG

Target Details CARD8

Produktdetails anti-CARD8 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CARD8 (CARD8 Antibody Abstract)
Hintergrund Gene Symbol: CARD8
Gen-ID 22900
Forschungsgebiet Apoptosis/Necrosis
Pathways Positive Regulation of Endopeptidase Activity

Anwendungsinformationen

Produktdetails anti-CARD8 Antikörper Target Details CARD8 Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CARD8 Antikörper Target Details CARD8 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CARD8 Antikörper Target Details CARD8 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Caspase Recruitment Domain Family, Member 8 (CARD8) antibody (ABIN4287924) Immunocytochemistry/Immunofluorescence: CARD8 Antibody [NBP2-47527] - Analysis of hum...
Immunohistochemistry (IHC) image for anti-Caspase Recruitment Domain Family, Member 8 (CARD8) antibody (ABIN4287924) Immunohistochemistry: CARD8 Antibody [NBP2-47527] - Analysis of human placenta tissue...
Western Blotting (WB) image for anti-Caspase Recruitment Domain Family, Member 8 (CARD8) antibody (ABIN4287924) Western Blot: CARD8 Antibody [NBP2-47527] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...