anti-Maus RPS6KB2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended RPS6KB2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) Antikörper
  • KLS
  • P70-beta
  • P70-beta-1
  • P70-beta-2
  • S6K-beta2
  • S6K2
  • SRK
  • STK14B
  • p70(S6K)-beta
  • p70S6Kb
  • 70kDa
  • ribosomal protein S6 kinase B2
  • ribosomal protein S6 kinase, polypeptide 2
  • RPS6KB2
  • Rps6kb2
Reaktivität
Human, Maus, Ratte (Rattus)
235
125
80
2
2
2
1
1
Wirt
Kaninchen
205
29
2
Klonalität
Polyklonal
Konjugat
Dieser RPS6KB2 Antikörper ist unkonjugiert
16
16
15
7
7
7
4
4
4
4
4
4
4
4
4
4
4
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
180
107
54
43
35
26
11
8
5
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4343182
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.864726 ABIN702850 IF (p) IHC (p) WB Rabbit IgG pThr444, pSer447 Anmelden zum Anzeigen Polyclonal 0
10.864726 ABIN2178141 IF (p) IHC (p) WB Rabbit IgG pSer370 Anmelden zum Anzeigen Polyclonal 0
1 ABIN659035 FACS IHC (p) WB Mouse IgG1, kappa Anmelden zum Anzeigen 164CT21-2-2 0
1 ABIN1500792 FACS IHC IHC (p) WB Mouse kappa, IgG1 Anmelden zum Anzeigen 0
1 ABIN732608 IF (p) IHC (p) WB Rabbit IgG AA 220-250, pThr228 Anmelden zum Anzeigen Polyclonal 0
1 ABIN5957340 ELISA IHC (p) WB Rabbit IgG Ser423 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1414719 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN701674 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1396842 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN701667 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN702859 IHC (p) WB HRP Rabbit IgG pThr444, pSer447 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2178164 IHC (p) WB HRP Rabbit IgG pTyr389 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1386764 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN701665 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN702852 IHC (p) WB Biotin Rabbit IgG pThr444, pSer447 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2178158 IHC (p) WB Biotin Rabbit IgG pTyr389 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2178153 IF (p) IHC (p) WB Rabbit IgG pTyr389 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1810405 FACS IHC IHC (p) WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) Antikörper
Reaktivität Human, Maus, Ratte (Rattus)
(235), (125), (80), (2), (2), (2), (1), (1)
Wirt Kaninchen
(205), (29), (2)
Klonalität
Polyklonal
Konjugat Dieser RPS6KB2 Antikörper ist unkonjugiert
(16), (16), (15), (7), (7), (7), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(180), (107), (54), (43), (35), (26), (11), (8), (5), (2), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-RPS6KB2 Antikörper

Target Details RPS6KB2 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Isotyp IgG
Plasmids, Primers & others

Target Details RPS6KB2

Produktdetails anti-RPS6KB2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung p70 S6 Kinase beta/s6k2 (RPS6KB2 Antibody Abstract)
Hintergrund Gene Symbol: RPS6KB2
Gen-ID 6199
Pathways PI3K-Akt Signalweg, RTK Signalweg, AMPK Signaling, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung

Anwendungsinformationen

Produktdetails anti-RPS6KB2 Antikörper Target Details RPS6KB2 Handhabung Bilder zurück nach oben
Applikations-hinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-RPS6KB2 Antikörper Target Details RPS6KB2 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-RPS6KB2 Antikörper Target Details RPS6KB2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Immunohistochemistry-Paraffin: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Immuno...
Western Blotting (WB) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: Marker [kDa] 23...
Western Blotting (WB) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: NIH-3T3 cell ly...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Immunohistochemistry-Paraffin: p70 S6 Kinase beta/S6K2 Antibody - Staining of human ...